SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156743369|ref|YP_001433498.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156743369|ref|YP_001433498.1|
Domain Number 1 Region: 269-690
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 8.5e-111
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000000000846
Further Details:      
 
Domain Number 2 Region: 169-282
Classification Level Classification E-value
Superfamily Cytochrome c 1.06e-16
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00044
Further Details:      
 
Domain Number 3 Region: 57-159
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000000168
Family monodomain cytochrome c 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156743369|ref|YP_001433498.1|
Sequence length 690
Comment hydroxylamine reductase [Roseiflexus castenholzii DSM 13941]
Sequence
MRPWKHIVFGAMLGLVVLVACARQAEVSPATAPTPIPQAAPVVATTAPPVDCALAAFQKG
GCGACHVIPGVPNARGTIGPDLTNVAQVAAQTMQSSTYTGNATTVEAYLREAILEPDVFV
APDCNGSPCQKGVMPPSLGQGLSEEELAAVIAYLQAPPGAAEAVVTEAPTAAPSEAAPTL
SDDEFAWAKLVYFERCAGCHGTLRKGATGPALTPDRTIPLGTVGLSTIIYNGTSRGMPDW
GKQGFFTKEQIEVLARFLQREPPAPPELPMERMKASWKMYVAPDQRPTAPQTKRNWQNYF
VVTLRDAGQVAVIDGDTYEVVSKVDSGYAVHITRMSATGRYAYVIGRDGKLAMIDLWTET
PAKVAEVQVCYDARSVEVSKYNGPEGDFTDKLAVVGCYWPPHFVILDGQTLEPIHIVSTR
GYTVDTMEYHPEPRVASIVASDFKPEWIINVKEIGQIWLVNYANPRAPQIKMLPAARFLH
DGGWDATHRYFLVAANQSNKVAVVDAQEGRMVALVDTPKIPHPGRGANWVDPEFGPVWSS
GHLGDPAIVSIGTDPEGHPNVAWKAVRVTPLPGAGSLFIKTHPNSKWIWVDMTLNSDPAL
ARTICVIAKENPAEPHTCWEASSYGRAVHFEYNAAGTEVWVSIWGDASKPGETGEIVVYD
DATLTEKARIPNLVTPTGKFNVYNTVHDIY
Download sequence
Identical sequences A7NPI4
WP_012121904.1.48654 gi|156743369|ref|YP_001433498.1| 383372.Rcas_3430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]