SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156744224|ref|YP_001434353.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156744224|ref|YP_001434353.1|
Domain Number 1 Region: 12-225
Classification Level Classification E-value
Superfamily PHP domain-like 1.31e-33
Family PHP domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156744224|ref|YP_001434353.1|
Sequence length 300
Comment phosphotransferase domain-containing protein [Roseiflexus castenholzii DSM 13941]
Sequence
MDQLPFRKPGRFYRGNLHTHSTVSDGELSPEDVVAAYRVQGYDFLALTDHFLPQYHFQIT
DTRPFRSAHFTTLLGAELHAPQTSAGRLWHIVAVGLPLDFEPTAPDETGPTLAARAAAAG
AFVGIAHPAWYTLTLDDGLSLDAAHAVEVFNATAAWDNDRGDSWHFSDMLLANGKRLLAY
AADDAHFSIRPDTFVAWVQVRAGELSPEALLDALKSGAFYSSQGPQIDDVDIDDRRVAVR
CSPARAVFVSGPDERSQRQLGQAITVCELPIPWIHEVPYIRVTVVDDAGRKAWTNPIWLG
Download sequence
Identical sequences A7NRY9
383372.Rcas_4309 WP_012122756.1.48654 gi|156744224|ref|YP_001434353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]