SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284030144|ref|YP_003380075.1| from Kribbella flavida DSM 17836

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284030144|ref|YP_003380075.1|
Domain Number 1 Region: 23-187
Classification Level Classification E-value
Superfamily Prim-pol domain 6.54e-31
Family Bifunctional DNA primase/polymerase N-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284030144|ref|YP_003380075.1|
Sequence length 308
Comment Bifunctional DNA primase/polymerase [Kribbella flavida DSM 17836]
Sequence
MTRATRPRTRRGELDAGQQLLSRAAHWHADRGMAVFPLVPGRKTPAVEDWEHAATTDHLS
IAQIWRRAPYNIGVAAGRSGLVVVDLDRPKGAGDTAPEPWHSRGAASGGDVLALLAADAG
QELPATYTVATASGGSHLYFRQPDGIRLGNTAGRLGWKIDTRGHGGYVVAAGSVTFAGWY
ATTSLTAPQPLPAWITGALTRSPDQPTAARTATQQLKDASAYTLAAVSGELDKLLAATEG
HRNDTLNRAAFALGQLVGADLLDQSTARDELLSAAGRLGLDRSEASRTISSGLTAGARHP
RRTVTLRQ
Download sequence
Identical sequences D2PTG3
gi|284030144|ref|YP_003380075.1| WP_012919832.1.69711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]