SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284030886|ref|YP_003380817.1| from Kribbella flavida DSM 17836

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284030886|ref|YP_003380817.1|
Domain Number 1 Region: 16-158
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-46
Family Ribonuclease PH domain 1-like 0.000000248
Further Details:      
 
Domain Number 2 Region: 327-499
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-43
Family Ribonuclease PH domain 1-like 0.000000498
Further Details:      
 
Domain Number 3 Region: 159-267
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.78e-26
Family Ribonuclease PH domain 2-like 0.00000707
Further Details:      
 
Domain Number 4 Region: 481-581
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.36e-24
Family Ribonuclease PH domain 2-like 0.0000156
Further Details:      
 
Domain Number 5 Region: 582-695
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.14e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 6 Region: 273-352
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.01e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284030886|ref|YP_003380817.1|
Sequence length 750
Comment guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase [Kribbella flavida DSM 17836]
Sequence
MSGSTNAPMEGADYAEAVIDNGSFGTRTIRFETGRLAQQAAGSAAAYLDGDTMVLSATTA
SKKPKDQFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSEEAILTCRLIDRPLRPSFVSG
LRNEIQVVITVLALNPDKLYDVLAINAASMSTQIAGLPFSGPIGATRVALIDKQWVAFPT
HSELEDAVFDMVVAGRVTDSGDVAIMMVEAESTPGTFDAVAAGKQAPTEEIVAEGLEAAK
GFIKTLVEAQSALAAKASKPTGEFPIFPDYADDAFAAVQAAATEELTQALTITGKQEREE
ATEAVKAAVVDKLAADFEGREKELSAAFRSLTKKLVRQRVLRDKVRMDGRGLADIRPLKA
QVKVLPRVHGSALFERGETQILGVTTLNMLRMEQQLDTLSPETRKRYMHNYNFPPYSTGE
TGRVGSPKRREIGHGALAERALVPVLPSREDFPYALRQVSEALGSNGSTSMGSVCASTLS
LLSAGVPLKAPVAGIAMGLISGEVDGKTEYVALTDILGAEDAFGDMDFKVAGTKDFVTAL
QLDTKLDGIPASVLAGALTQAKEARLTILDVMAKAIDAPGEMSEFAPRVISVKVPVDKIG
EVIGPKGKMINQITEDTGADISIEDDGTVYIGATDGPSAEAARAAINAIANPTMPEKGER
YLGTVVKTTNFGAFISLLPGKDGLLHISKLRGLAGGKRVEAVEDILSVGQKLQVEIAEID
DRGKLSLIPVVEGEDGGSDKADESEAAPAE
Download sequence
Identical sequences D2Q1M9
gi|284030886|ref|YP_003380817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]