SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290473308|ref|YP_003466174.1| from Xenorhabdus bovienii SS-2004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290473308|ref|YP_003466174.1|
Domain Number 1 Region: 17-206
Classification Level Classification E-value
Superfamily HAD-like 1.48e-39
Family YihX-like 0.00000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290473308|ref|YP_003466174.1|
Sequence length 219
Comment phosphatase-like domain-containing protein [Xenorhabdus bovienii SS-2004]
Sequence
MIKVQNDNRQSGGIMLYIFDMGNVIIDIDFKRVLAVWSNLSGTPLATLTTRFSMGEAFEQ
HECGQITDTAFAEALCDEMEVSLSFEQFTEGWHALFIDVRQDVIELMNKLREQGHRVVVL
SNTNRLHFDYWPHHYPEIAASTDFLYLSQDLGMRKPNSDIFKYVLGAEGVTAVQAVFFDD
VLVNVEAARKIGINAIHVTDRSVIPDYFKAHDFSLPSET
Download sequence
Identical sequences D3UYJ8
gi|290473308|ref|YP_003466174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]