SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290954689|ref|YP_003485871.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290954689|ref|YP_003485871.1|
Domain Number 1 Region: 23-354
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.84e-77
Family Putative alpha-L-fucosidase, catalytic domain 0.0000357
Further Details:      
 
Domain Number 2 Region: 535-669
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.72e-23
Family Ricin B-like 0.0033
Further Details:      
 
Domain Number 3 Region: 449-532
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000000000409
Family Crystallins/Ca-binding development proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290954689|ref|YP_003485871.1|
Sequence length 671
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MKAAALAGGVAAFGLPQALWPATAEAYTVPSKMDWWYQARFGMFIHFGSYSYLGQGEWAF
DSQQWSKANYQNQVTQNFNPTQFNAATIAELAKNAGMKYLVITAKHHEGYAMWNSDVAGF
TDTTGTKLYNLRDFNGIQTDPLMNLKTECESRGIKFCLYYSILDWNHPSQTDRHESGLTT
MSSQAARTAYIADMKAQLQELLDRYDPALLWFDGDWFAEPSSPTLEDWWLESDGVDLYNW
LIARKPGLIVNERVKRDHGLGDYAVAEFGIPAEPMGRPWERCATMNGAWGYQAGRENSYR
SVKDVVQELVTVVSRDGNLLLNIGPKGDGSVTAGTQTVLNGLASWMSTYSDSIHGTSGSP
FATEPAWGRVTKKSGKLFAHVFTWPTNGQLRIPVIDNTISRVYLLNNPSVSLPYTVTDQI
NVTVPATAPNANASVVCVEVQGMPVRVSATVFQNVDYQGARAVLPLGSYTSSQLSAAGLA
PAAASSILVPDGYQVTGYSGDNFTGTAWTFTSNTPDLGVTGNNDVIRSLKVTFRPDKYFR
LNNVTNHWALDSGGNVASGSNLKQWESIDHANLQWQAIELGNGYYRLVNRTNGMVADGWG
ATSNGDPARQKAWDGSNTQQWRITHRGQGQYSIANRSTGLVLDGGGMVAAGAVAKQWTWQ
QHTNLLWTFGA
Download sequence
Identical sequences C9ZBE6 M3FX37
gi|290954689|ref|YP_003485871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]