SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290954982|ref|YP_003486164.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290954982|ref|YP_003486164.1|
Domain Number 1 Region: 37-338
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.4e-62
Family Putative alpha-L-fucosidase, catalytic domain 0.003
Further Details:      
 
Domain Number 2 Region: 510-648
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.57e-42
Family Ricin B-like 0.0025
Further Details:      
 
Domain Number 3 Region: 375-484
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000078
Family Galactose-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290954982|ref|YP_003486164.1|
Sequence length 650
Comment fucosidase [Streptomyces scabiei 87.22]
Sequence
MSFGSLSRRSLLGAAGAAAAATALPVVPALSPLLAKAAAADPQSSLEKLVDMRFGMFNHF
SLGTFTDEEWAEPNQNPALFAPTAVDCAQWAAAAAAAKMSYGILTTKHHDGFALWPSAYG
TQNVANSPYKQDVVKAYCDAFRAKGLRVAFYYSIWDRTFGVEAWENRHRVSGLEITDAIQ
PADMTFILGQITELLSNYGTIDMFITDGYAWQMGQQAAPYQRIRRHVKSLQPDIVMIDHG
ALSVPWLGDAIYFEEPLGVSAPAGNTYAATQGQTISNGWFWHPSTPTEGLMSKNAILSHL
ADLEPKYTSFILNCPPNRNGRLDTNIVNRLAEVGAAWSPDTSRPSLPAQPLRAEHPVTPV
NAYATAFRTGEGPLHAIDGLSDKGYETCWSTWGLPTPLPHSITIDLGGVWSKVSTLEYLP
KQWNRTGTTDGDITSYTISTSTDGTNFTQVATGTWAGDRAPKVAEWPARNAGFVRIQANA
ATGGYANMGGVHIGGRTAEPALVSRVLPGDGTVYRLVNRKSGKVVDVYDFGTADGARIQQ
WPWLDNTAQKWTFASTGDGYYEIKNVNSRKLMEVAGLSRADGGNVALYTDHDVPQQHWAV
TPTGDGAYYLTNRFSGLALSVDAGSTADGADIEQFTYRRLPEQQWQIIAL
Download sequence
Identical sequences C9YSR8
WP_012998330.1.11737 WP_012998330.1.94791 gi|290954982|ref|YP_003486164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]