SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290954983|ref|YP_003486165.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290954983|ref|YP_003486165.1|
Domain Number 1 Region: 629-766
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.28e-34
Family Ricin B-like 0.0072
Further Details:      
 
Domain Number 2 Region: 111-146,176-409
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.00000000000128
Family N-acylglucosamine (NAG) epimerase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290954983|ref|YP_003486165.1|
Sequence length 768
Comment hypothetical protein SCAB_3871 [Streptomyces scabiei 87.22]
Sequence
MTSPVSRRRLLQAAGASAAASAAGSLIGPSAAHAAVPPARADIGVLAHPFGLGQVRLTAS
RWLDNQDRTRNYLRFVDVDRLLYNFRANHRLSTAGAAATGGWDAPTFPFRTHVQGHFLTA
WAQLYAVTGDTTCRDKATRMVAELAKCQANNGAAGFNTGYLSGYPESDFTALEQRTLSNG
NVPYYTIHKTLAGLLDVWRHIGSTQARDVLLALAGWVDWRTGRLTGQQMQAMLQTEFGGM
NAVLTDLYQQTGDARWLTAARRFDHAAVFDPLASNQDRLSGLHANTQVPKWIGAAREYKA
TGTTRYRDIATNAWSITVAAHTYAIGGNSQAEHFRAPNAIAGFLNQDTCESCNTFNMLVL
TRELFALDPNRAALFDYYERAWLNQMIGQQNPADDHGHVTYFTPLRPGGRRGVGPAWGGG
TWSTDYGTFWCCQGTGLEMHTRLMDSVYYRSDTTLIVNMFVPSVLTWSERGITVTQTTDY
PAGDTTTLRVTGSVGGTWAMRLRIPGWTSGATISVNGTAQDIATTPGSYATLTRSWTSGD
TVTVRLPMRIVMRAANDNANIAAITYGPVVLSGDYGDSALGSPPSLKTSSITRTSTGSLA
FTATANGSTVGLGPFHDAHGHNYAVYWSTGDTVRLTNVGSGLVLGIQNMSTADGGRALQW
NDSGTADHDWQMITDGSAVRLRNAHSGKVLGVQDMSTADNATVLQWSDTGTADHRWTLLD
QGDGTYKIRNVNSGKLLAIANNSTAVGAFAVQAPDDGTADNRWRVVKN
Download sequence
Identical sequences C9YSR9
WP_012998331.1.11737 WP_012998331.1.94791 gi|290954983|ref|YP_003486165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]