SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290954984|ref|YP_003486166.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290954984|ref|YP_003486166.1|
Domain Number 1 Region: 20-147
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.11e-38
Family Ricin B-like 0.0000158
Further Details:      
 
Domain Number 2 Region: 175-439
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.46e-29
Family alpha-L-arabinanase-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290954984|ref|YP_003486166.1|
Sequence length 458
Comment arabinofuranosidase [Streptomyces scabiei 87.22]
Sequence
MLLAALVASAATLVATPAQAATTGALRGTGSGRCLDVSGANQADGTNVQIWDCWSGTNQQ
WTLTDDNRLTVYGTKCLDVPGHATTPGTRPVIRACNGGTNQEWRVNADGAVVGVESGLCL
DMAGGATANGTAVQLATCNGSAGQKWTGLSGSGSACTLPSTYRWSSTGPLAQPSNGWYSL
KDFTTVTYNGKHLVYATNSSGSGWHSMMFSPFTNWSDMASAPQTQMNQGAVAPTLFYFAP
KNIWVLTSNGWGTQWPFVYRTSSDPTNPNGWSAAQPLFTGSVPNGTAIDPTLIADGQNMY
MFFAGDNGQIYRSAMPIGNFPASFGSSYTTIMSDTVKNLFEAPQVYKVQGQNQYLMIVEA
RGANEQRFFRSFTASSLNGTWTPQAATESNPFAGKANSGATWTNDISHGDLVRDNPDQTM
TVDPCNLRLLYQGLSPGTPSNTPYAQLPYRPGLLTLQR
Download sequence
Identical sequences C9YSS0
WP_012998332.1.11737 WP_012998332.1.15999 WP_012998332.1.2165 WP_012998332.1.21818 WP_012998332.1.32552 WP_012998332.1.82449 WP_012998332.1.94791 gi|290954984|ref|YP_003486166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]