SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290955221|ref|YP_003486403.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955221|ref|YP_003486403.1|
Domain Number 1 Region: 445-518
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000144
Family Ricin B-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290955221|ref|YP_003486403.1|
Sequence length 609
Comment hydrolase [Streptomyces scabiei 87.22]
Sequence
MSTEPRRAVSTVRNREETRFMDGAPVVAAPHGGRGRVAPGGEVGHEPAVPAEFSDVGHEP
VVPAEFAQTESVEAGGAAGVPSAAELLALHGTSVLRYASLCVERNPGAEQDRGTAERLAG
LAFRTTHGDVAAHAGADFPWRPRLLSAVLDAAGEWNADDRRSSLHPDLRGDLAGDARRPL
PGGDRGSGARSLVLRAFHNLPHRAQTLLWHTVVEAEDIGTVAALLGADPALLNPERARTQ
LRDACGRLHLDRARDERCRRLHRLIDVHARRGATEVMAEVRDHLDGCSYCRAAVDQLDQS
PERLPALLAEAVLGFRAADYLATRPVRRERPGPSADAPARVSDDARPEPTARPAQAQARP
AEGDRSAPRRLRWPLPAALGVLLCGVIAASPMALGGAGGDSETVGGSVAVPTPSPSATAS
APSGVAPAPDTPPDTSSSPGGNEAPATRLRNVRTGLCLDLRGSAAVLGTPAVTARCEGSA
SQLWRWDGEGRLRNQAAPELCLNAEPQGTVALRPCAATEEGEEPANGEGTTAGGNATAEE
DATAGEESADTRYALASDGLLTLVAEPGVAVTPVRRAEGAVILLEPVPQDRVRRSQRWLT
DEGFAGAVS
Download sequence
Identical sequences C9YVT4
WP_012998568.1.94791 gi|290955221|ref|YP_003486403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]