SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290955228|ref|YP_003486410.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955228|ref|YP_003486410.1|
Domain Number 1 Region: 39-391
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.43e-79
Family Putative alpha-L-fucosidase, catalytic domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 606-741
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.51e-27
Family Ricin B-like 0.0022
Further Details:      
 
Domain Number 3 Region: 521-604
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000000311
Family Crystallins/Ca-binding development proteins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290955228|ref|YP_003486410.1|
Sequence length 743
Comment alpha-L-fucosidase [Streptomyces scabiei 87.22]
Sequence
MSSSISRRRLLAGATCVAAAAVAGGVLGAGTAQAAPSTYTPDWSSVDQHPPAPEWFQDAK
FGIYFHWGAFSVPAYDNEWYPRSMYQSGSNANKHHTATYGSPSSWPYRNFIDGARDLAGN
TVKFAPKLKSAGGNFDPDEWVQLFVDAGAKFAGPVAEHHDGFSMWDSQVNEWNSVDKGPG
LDLLDLFATAIRGRNLKLLVAMHHAYNYNGFYEFAPAQSDTGLKKLYGQLSRAAEDQLWY
DKLKEVIDRAKPDILWQDFKLDAVDETQRLKFLSYYYNQANSWGREVVATYKDGMNGKGE
MFDYERGGPGDLTAPYWLTDDSISSSSWCYTQGIGYYSTQQMLHSFLDRVSKNGNVLLNI
APMADGTIPQAQKNILLGIGDHLKRFGESVYATRAWTAYGEGPTKMGGGSFTTPHAGTAQ
DIRFTRNKAGTVLYATVLGWPGGSVTIKTLTSDRISLSSLTSVKLLGTTAGTYTDLPAPV
QNSSGLTVTLPSSAPYTADAYVLKLTFSGQIPSLRPLAGAVAFRDVDYAGTGAVLPVGDH
TADALTAAGLGTLALSSLRLAPGYQVVGYAGDGFTGTSWTFTADNPDLRVTGNNDKVTSL
RVQFRPTTYFRIDNVTNGLSLDSGGNVASGSDLKQWTWDGHNNLQWQVVDVGGGYVRLVN
RTNGMVADGWGATANGSAARQAAWNGSANQQWRITHRGDGRHSIANRGTGMVLDGAGNAA
SGSVAKQWAYDSSTNLLWTFTAL
Download sequence
Identical sequences C9YX59
gi|290955228|ref|YP_003486410.1| WP_012998575.1.11737 WP_012998575.1.12502 WP_012998575.1.15999 WP_012998575.1.2165 WP_012998575.1.32552 WP_012998575.1.57887 WP_012998575.1.82449 WP_012998575.1.93747 WP_012998575.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]