SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290955314|ref|YP_003486496.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955314|ref|YP_003486496.1|
Domain Number 1 Region: 4-394
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.57e-69
Family Amylase, catalytic domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 402-630
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.53e-25
Family A4 beta-galactosidase middle domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|290955314|ref|YP_003486496.1|
Domain Number - Region: 651-700
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0396
Family alpha-Amylases, C-terminal beta-sheet domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290955314|ref|YP_003486496.1|
Sequence length 706
Comment beta-galactosidase [Streptomyces scabiei 87.22]
Sequence
MLFGAAYYHEYQPYEQPAERLKTDLDLMADAHVSVIRVGESVWSTWEPENGTFDLDWLQP
VLDGAHERGISVVLGTPTYAAPPWLARQYPEITAERRTGERMGWGARQEIDFTHPAFRFH
AERVIRKVVGRYAGHPAVIGFQVDNEPGLHLFHNHGVFQRFVDHLREKYGDVETLNREWG
LVYWSHRLSTWADLWTPDGNEQPQYDVAWREFQARQVTEFIGWQADLVREYASPEQFVTT
CISYTRQGVEDDELTNRLDIASGNPYYDMQDGLLLPDPTPEGHEQKWKTTGVWSLYQTAD
WMFSSLQEPFLVTETNAGSIGMAWDNRPGYDGQWRQAAWALVSRGARMIEYWHWHTLHFG
AETYWGGILPHTGQPGRTYAELARLGAEFEAAGPLVAGLEPDADITMVYSTPSKWLMQKY
PPLATPDGEPDPAAYHRIFDPFYRGAFEAGRQVRIVHARQLHDPSGEREGLSPEEAVRRH
PVLVVPALYVAADATLDWLAAYADAGGHLVLGPRTGYADHEARARAERAPGRLTEAAGVG
YDEFSNLTREVPVRSAPGGPLRLPEDATATRWADGLTLTDADVLVTYDHPHFGRWPAVTT
RRHGEGRVTYVGTVPGRGLGRALAAWLTPDARHAWSGLPETVTATTGTAPDGRRVHIVHN
WAWEPASVPVPVPLSDALTGADLPAGTPLELGPWDVRVLVTTDTDA
Download sequence
Identical sequences C9YYM0
gi|290955314|ref|YP_003486496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]