SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290955315|ref|YP_003486497.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955315|ref|YP_003486497.1|
Domain Number 1 Region: 439-582
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000315
Family GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain 0.088
Further Details:      
 
Domain Number 2 Region: 50-332
Classification Level Classification E-value
Superfamily Sialidases 0.000000000491
Family Sialidases (neuraminidases) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290955315|ref|YP_003486497.1|
Sequence length 582
Comment hypothetical protein SCAB_7371 [Streptomyces scabiei 87.22]
Sequence
MLAMPLTAQAYAPTGGTVYQLGSEPCLKGRGNCAVYPKSAQLPNGRLVASFEKSTVVTAT
GSADRQTMPVYKSDDDGTTWQPLSEVKAPAYLSDDPAFAKYTSNWTNPFLYVLPDRVGDL
QAGTLLLASVVSGDDQYYKEHKAADPNWTPSNDGDRKDMAIALYSSTDNGVTWKVVNVVA
TGGWQGGSAGAVGQNIAKANTYKQVDPLWEPYLMVRKNKLVCFYSDENDYVGFDPATGIP
KPDPANDTAKDSHGQILVHKTWNGKSKKWSEPVVDIAGRTEDMGGGKTEIGGGRPGMTTL
VPTADEKWLLTYEYWGGGANTRYRIANDPLKFFQGSPTGMGVDALPVVAGSRPLAQGGSP
VVIGLPDGRLVYNAANSGSVWVNESGRSDGVWKEYQTTSRAGYSRNLQYVDDTGRVVILN
NQGTSVIAFAEIDLGHSAGAYKQLVNRKTGQVIGTGNNTTDANLGNADVPDVVLEDAGTA
ADPATQYWHVVTKSDGAVTLLNKSGGRAASVWTGSATAGQRIGQWVDDSAAGTWNVVQSA
DGHVKLQSARNKSLYLTGASPDAPLTLQNATTDGSQDWKLTP
Download sequence
Identical sequences C9YYM1
WP_012998662.1.11737 WP_012998662.1.94791 gi|290955315|ref|YP_003486497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]