SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290955577|ref|YP_003486759.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955577|ref|YP_003486759.1|
Domain Number 1 Region: 647-784
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.31e-33
Family Ricin B-like 0.0053
Further Details:      
 
Domain Number 2 Region: 113-165,202-425
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0000000000000884
Family Cellulases catalytic domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290955577|ref|YP_003486759.1|
Sequence length 786
Comment hypothetical protein SCAB_10131 [Streptomyces scabiei 87.22]
Sequence
MSRHITKSKQPLCRIERLTMSPSVSRRRLLQLAGATVAASATGSLVGASSAQAAIAPART
DIGVLAHPFELGQVRLTASRWLDNQNRTQNYLRFIDVDRLLYNFRATHKLSTNGATPNGG
WDAPNFGFRTHIQGHFLTAWAQLYAVTGDTTCRDKATRMVAELAKCQANNSAAGFNTGYL
SGYPESNFTALEQGTSGEVLYYTIHKTLTGLLDVWRLIGSTQARDVLLALAGWVDWRTGR
LTGQQMQTMLRIEFGGMNTVLTDLYQQTGDARWLTVAQRFDHAAVFDPLAANQDKLNGLH
ANTQVPKWIGAAREYKATGTTRYRDIATNAWNITVAAHTYAIGGNSQAEHFRAPNAIAGF
LNNDTCESCNTVNMLTLTRELYTLDPDRVELFDYYERAWLNQMIGQQNPADDHGHVTYFT
PLKPGGRRGVGPALGGGTWSTDYGSFWCCQGTGLEMHTRLMDSIYFHNDTTLTVNMFVPS
VLTWTERGITVTQTTTYPTSDTTTLQVTGSVSGTWAMRIRIPGWTTGAAVSVNGVAQNIT
TTPGSYATLNRSWTSGDTVTVRLPMRIGIRPANDNANVAAITYGPVVLSGNYGDSTLSSL
PALTTSSIKRTSSSSLAFTATSSGSTVNLGPFYDAHGFNYTVYWNTTGNTVRLVNASSGL
LLGIQNMSTSNGGRALQWTDNGTADHNWEMVTDGSAIRFRNAHSGKVLGVLNMDTADGAT
VLQWSDNGTADHKWTLLGQGDGTYKIRNVNSGRLLAIAGNSTAVGAFAVQDADDGTADNR
WRIVLN
Download sequence
Identical sequences C9Z3D2
gi|290955577|ref|YP_003486759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]