SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290955578|ref|YP_003486760.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955578|ref|YP_003486760.1|
Domain Number 1 Region: 338-474
Classification Level Classification E-value
Superfamily AbfB domain 1.44e-40
Family AbfB domain 0.00023
Further Details:      
 
Domain Number 2 Region: 79-281
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.0000000000000146
Family alpha-L-arabinanase-like 0.042
Further Details:      
 
Domain Number 3 Region: 35-101
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.0000942
Family alpha-L-arabinanase-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290955578|ref|YP_003486760.1|
Sequence length 475
Comment glycosidase [Streptomyces scabiei 87.22]
Sequence
MSALRARLTVILLAVCLLFTGQALTTPQRAAAADPGYLMVHFTGDSATGQMLYLAHSTDG
MHWNDLNGGAPILNSKIGTKGVRDPALVRSPDGSKYWIIATDLCIRCGSTYTNGSPNFVV
WESTDLVTWSKPWLLGAAGLVPGGKNAWAPEAIWNPETNDYVLYWATNATVNGIFKYRIY
SARTKDFRTITTPQIWIDPPGSTPVVDTQMTEVPGGTGPYRYLRASGDGQNNIEGSNSIL
GTWTNLGNLSSIGLTGNVVEGPVWMKFRDRDEWALYIDHNNAQGVREYRPILTTNPFDVS
TYRLQPTTSYDMGGTPKRHGAIMTLTAAEESRVLSRWPNTPAQRLQSYNFQDRYVRQTDF
DVRIDPNVTPVEDSQFRIRPGLAGTGTVSFESVAHPGYFLRHANYDVQLVLNDGSSQFAA
DATFRKAAGLADSTWSSFQSYNFPDRYIRHYAYQLRLDPITTTTARGDATFRVTN
Download sequence
Identical sequences C9Z3D3
WP_012998920.1.11737 WP_012998920.1.12502 WP_012998920.1.15999 WP_012998920.1.2165 WP_012998920.1.21818 WP_012998920.1.57887 WP_012998920.1.82449 WP_012998920.1.93747 WP_012998920.1.94791 gi|290955578|ref|YP_003486760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]