SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290955699|ref|YP_003486881.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955699|ref|YP_003486881.1|
Domain Number 1 Region: 1143-1423
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.19e-76
Family alpha-L-arabinanase-like 0.00072
Further Details:      
 
Domain Number 2 Region: 837-1054
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.51e-32
Family Clostridium neurotoxins, the second last domain 0.051
Further Details:      
 
Domain Number 3 Region: 493-754
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.71e-31
Family alpha-L-arabinanase-like 0.016
Further Details:      
 
Domain Number 4 Region: 44-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.12e-26
Family Leech intramolecular trans-sialidase, N-terminal domain 0.08
Further Details:      
 
Domain Number 5 Region: 1477-1596
Classification Level Classification E-value
Superfamily PKD domain 0.00000000275
Family PKD domain 0.0049
Further Details:      
 
Weak hits

Sequence:  gi|290955699|ref|YP_003486881.1|
Domain Number - Region: 443-513
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.000377
Family alpha-L-arabinanase-like 0.082
Further Details:      
 
Domain Number - Region: 266-334
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000471
Family Invasin/intimin cell-adhesion fragments 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290955699|ref|YP_003486881.1|
Sequence length 1730
Comment hydrolase [Streptomyces scabiei 87.22]
Sequence
MTYIERLRGRARRWAGPLAGLTAASLVLGLAGPAAPAAADAAGLTDGLALWYKLDATSGS
KAVDASGHGRDGTVNGTAGWTGNGQGLSFNGSDTYIKVPNDVMKGMDSISVSMDVLMDEA
QTGPYFIYGFGNSSSGTGNGYLFATGNSLRTAIASGNWSTEQNTRPSDGHNLSRSVWKQL
TYTQTGTTGVLYEDGAEVGRNTSVTTTPGSIGAGTTTANYIGKSVYTGDKLFQGKIRDFR
VYDRALAGSEVEQLALPIAEEGLAADKAALTLGDTSAVTADLTLPKTGTAGGSTITWKSD
NTGVVSNSGAVTRPAAGEPNGHATLTATLKKGPATATKSFEVTVLPTFDDTTAVKQAAEA
LTVHNLDDVRGNLTLPGDGGFGTKVAWSSANPDVVSANGVVKRPAHGGGDTTAALTATVT
KGDAKTTRTFTAKVPELPAKEALKGYMFSYFTGEGTSDGEQLYAALSKGNDPLKWRELND
GKPVLTSTLGEKGLRDPFIIRSPEGDKFYQIATDLKIYGNGDWDASQRTGSKSIMVWEST
DLVHWTNQRLVKVSPDSAGNTWAPEAYYDDQRGEYVVFWASKLYDNEAHSGDTYNRMMYA
TTRDFYTFSEPKVWVDRGYSVIDSTVIQHDGEYYRLSKDERNNSSSTPNSKFIFEEKSDT
LRSLSWTAVAEGIGKGTMSAAEGPLVFKSNTEDKWYAFLDEFGGRGYIPFETKDLDSGVW
TPSTNYDLPSKPRHGTVLPVTQSEYDRLLKTYQPDGIVTSVEDVKVTTRIGDAPVLPATV
IAEFADGAKRPVAVTWADVDPSKYAQAGTFTVKGDLPGDSAIEVRAEVTVSTGGPDVPAD
LLVHYGFDEKGGSIARDSSGHGYHGTYVRTPDFATGVDGGSFKMSGGNSGSSSPYVKIPN
GVLKGADSVTVSTYAKWKGGDNWQWLFGLGPDSNKYLFASPSNGSSSLYSAITAASWGAE
KKLSGARLTPGKWQHVTVTVDGGAKTAILYADGVEVSRATDVSVKPSDLYDANKDYSGYI
GRSMYSPDPYFGGEVDDFRIYDRALKPAEILEISGNTTGIAKVTHPAQKTDAVIDDAGSR
VTLPMKPGTDLTKLAPEFTLAHGAKISPASGTAQNFTKPVKYEVTGSDGKKRTWTVSARE
LKSPVLPGLNADPNIVRFGDTFYIYPTTDGFEGWSGTQFKAYSSKDLVNWKDHGVILDLG
PDVSWADSRAWAPAMEERDGKYYFYFCADANIGVAVSDSPTGPFKDALGKPLLKAGTLPG
QMIDPAVFTDDDGKSYLYWGNGRAYVVPLNDDMVSFDSAKISDITPSGYNEGTFVIKRKG
TYYFMWSENDTRDENYQVAYATGSSPTGPWTKRGVILEKDLSLGVKGPGHHSVVHVPGTD
DWYIAYHRFAIPGGDGTHRETTIDKLEFDADGLLKKVVPTLESIDPVTIARAGADVSGKE
GSKIQLNGTVSGAGTAKWTAEKGAPCVFADAGSARTTITCADNGTYEVTLTGGRSSDTAT
VTVTNAAPEITSVSSGKTVETGKVTRVRVKFTDAGTRDEHTCRIDWKDGSKPAAGKVTAG
SCKAEHTYRTAGLFAPVITVTDDDGASVSHTVAELVVYDRKAGGATGDGSFTSPAGAYPA
GPKLTGKADFSFTAAYGKSGNKPSGKVAFDFAGAKLKFRSTSTEWLVVTGSEAVLQGYGT
VNGKGGYLFRVTATDGPDTFQIKIWKKSDGKVVYDNRTASTTKGVTIGRK
Download sequence
Identical sequences C9Z507
gi|290955699|ref|YP_003486881.1| WP_012999041.1.12502 WP_012999041.1.15999 WP_012999041.1.21818 WP_012999041.1.32552 WP_012999041.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]