SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290956170|ref|YP_003487352.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290956170|ref|YP_003487352.1|
Domain Number 1 Region: 314-456
Classification Level Classification E-value
Superfamily AbfB domain 2.88e-39
Family AbfB domain 0.00012
Further Details:      
 
Domain Number 2 Region: 75-293
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.01e-22
Family alpha-L-arabinanase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290956170|ref|YP_003487352.1|
Sequence length 456
Comment glycosylhydrolase [Streptomyces scabiei 87.22]
Sequence
MNTTRRAVIALLTSVAALLGLTTAVASPAGAAHPAAGQATRYTMTAFTNSSESNMYVYDS
PDATGFTLRKGPAYTPPSGLIRDPSIFKHTDGYYYLTYTTRTWSALSTTIGFARSTDRLN
WTFLYDYTVPISGLQRAWAPEWFVDTNGSVNIILSASVAADGEYIFKPYKLTATNSALTA
WSAPTRLSGIGPNYIDTFIVKIGSTYHAFTKNETTKYIEYGTASSLTGPYTITKTGNWAG
FGSGMEGPALVQLDNGGWRIYYDAYGAGKYWYSDSYDNFATWSAPTELPGLTGFVRHLTV
LKETVSGGVTLPVNTTRSLQSVNFTGRYAVARSDNLGYVDPVTSSSTTAVKQSATFTVVP
GLADANCYSFRTSTGRYLRHWDYRIRSDADDGTTVFDKDATYCARPGTASGSVRLESYNY
PGRYIRHYNYELRLDTYEATDTFRTDSSFTAVSPWA
Download sequence
Identical sequences C9ZD59
WP_012999512.1.11737 WP_012999512.1.12502 WP_012999512.1.21818 WP_012999512.1.94791 gi|290956170|ref|YP_003487352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]