SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290956461|ref|YP_003487643.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290956461|ref|YP_003487643.1|
Domain Number 1 Region: 43-349
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.02e-65
Family alpha-L-arabinanase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290956461|ref|YP_003487643.1|
Sequence length 357
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MSREHELPQPPDRRLLLKGALAAGALAALPPTAAHASPGRPAYVNPLVRNRADPHINRHT
DGFYYFTATAPEYDRIVLRRSRTLRGLSTAAESVIWRKHATGVMGAHIWAPEIHRIDGKW
YIYFASAPAEDIWAIRIWVLENAHPDPFKGTWVERGQLKTAWETFSLDATTFTHRGSRYL
AWAQHEPGMDNNTAVWLSKMADPLTLTGPQVRLTTPELDWEVIGFKVNEGPSVIKRNGRL
FMTYSASATDFHYCMGLLTIDADADLMNPAHWSKSPTPVFTSNDTTRQYGPGHNSFTVAE
DGRTDVLVYHARQYKDIVGDPLNDPNRHTRIQRLGWKPDGTPDFGVPVADTTTPNTR
Download sequence
Identical sequences A0A100JV66 C9YT64
WP_012999802.1.12502 WP_012999802.1.21818 WP_012999802.1.36687 WP_012999802.1.57887 WP_012999802.1.93747 WP_012999802.1.94791 gi|290956461|ref|YP_003487643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]