SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290956788|ref|YP_003487970.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290956788|ref|YP_003487970.1|
Domain Number 1 Region: 237-363
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.55e-42
Family Ricin B-like 0.00016
Further Details:      
 
Domain Number 2 Region: 26-224
Classification Level Classification E-value
Superfamily SGNH hydrolase 8.4e-34
Family Acetylhydrolase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290956788|ref|YP_003487970.1|
Sequence length 368
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MRRPWILPLVALVTAALGMTAAGVAPASAASDTPLRVMPLGDSITWGVGSSTGNGYRGPL
WNELAADGHPLDFVGSVRSGSMSDPDNEGHPGYKIHQVAAFTDASLTRYRPNVVTLHLGT
NDLNESYQVSTAADRLRSLVDQITAAAPDATVLVASLVVSTSGSEEQYRAAYNQAVPRIV
SDAQAAGKKVAYVDMSSLTTADLDDTLHPNDSGYRKMADAFHRGVRSADSAGWLRSPAPA
PARVQSGIAGKCMDVKGAGTADGTAVQTWSCGGSANQLWSAYTDGTLRSMGKCLDAAGRG
TANGTKVQLWSCHGGANQVWQPYNGGYRNPASGRCLDVPGASTADGSQLVLWDCNGGSHQ
KWTPLTPG
Download sequence
Identical sequences C9YYV4
gi|290956788|ref|YP_003487970.1| WP_013000108.1.11737 WP_013000108.1.15999 WP_013000108.1.2165 WP_013000108.1.21818 WP_013000108.1.32552 WP_013000108.1.57887 WP_013000108.1.82449 WP_013000108.1.93747 WP_013000108.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]