SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290956988|ref|YP_003488170.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290956988|ref|YP_003488170.1|
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 7.72e-27
Family N-terminal domain of MutM-like DNA repair proteins 0.00057
Further Details:      
 
Domain Number 2 Region: 123-203
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.12e-19
Family Middle domain of MutM-like DNA repair proteins 0.0063
Further Details:      
 
Domain Number 3 Region: 210-260
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000163
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290956988|ref|YP_003488170.1|
Sequence length 284
Comment DNA glycosylase [Streptomyces scabiei 87.22]
Sequence
MPEGDTVWQAARRLDTALAGQMLSRSDLRVPKYATADLTGRTVLDVTPRGKHLLTRVEGG
LTLHSHLRMDGSWKVYASGERWRGGPTHQIRAILGTTERTAVGYRLPVLELMRTADEHRA
VGHLGPDLLGPDWDPELALANLLGDPGRALGEALLDQRNLAGIGNVYKSELCFLLRVTPW
IPVGALPAEVAARLPDLAKKVLEANRDRPIRNTTGHRRHDLFVYGRAPRPCLRCHTPVRA
ADQGDGSRERPTYWCPTCQPGPAPLPGATRTPRSHSRVQRRTTN
Download sequence
Identical sequences C9Z219
gi|290956988|ref|YP_003488170.1| WP_013000301.1.11737 WP_013000301.1.12502 WP_013000301.1.15999 WP_013000301.1.2165 WP_013000301.1.32552 WP_013000301.1.57887 WP_013000301.1.82449 WP_013000301.1.93747 WP_013000301.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]