SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290957035|ref|YP_003488217.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290957035|ref|YP_003488217.1|
Domain Number 1 Region: 233-592
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.33e-64
Family YicI catalytic domain-like 0.0000825
Further Details:      
 
Domain Number 2 Region: 26-228
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.54e-29
Family YicI N-terminal domain-like 0.0049
Further Details:      
 
Domain Number 3 Region: 594-674
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.55e-25
Family Putative glucosidase YicI, domain 3 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290957035|ref|YP_003488217.1|
Sequence length 683
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MNLSAENPTPTGAVSLAQSSPTVGTFRERDGALEWSGRQETLRIEPWGPDAVRVRARLGG
PVLDGLPGALLDEAESTGSTVKIEDGLGRLIVGALTVEVDAEGLVRYTRTADGSELLSEA
RAHFWWPGSRLYTAVGNGHHRLEQRFAAYDDEKLYGLGQHQHGRLDQKGLVLDLVQRNAE
VGIPVLTSSRGYTLLWNNPAIGRVELAGNGTRWVADSARQIDYWITAGAPAEAQRRYSAV
TGRAPMLPAWAAGFWQCKLRYRTQDELLAVAREYKRRGLPIDVIVCDFFHWTHLGEWKFD
PAEWPDPAAMVRELEELGIRLVVSVWPSVSPLSENHHLMEQRGYFIGTQYGPMAHADWPD
KEVASTVQVAFYDATNPEAREFVWSRVRENYLEPYGIKAFWLDACEPEIKPGFQENLRYW
AGPGPEVGNMYPAEVARTFYEGLRATGEEEIVSLNRSAWAGSQRWGAALWSGDIGTDFPT
LRRQIAAGLNTALSGIPWWNTDIGGFHGGDPDDPAYREVMVRWFQFGTFSPLMRLHGFRE
PGMPLGPAMTGGPNEVWSYGEEAGVILEDCLRLRERLKPYVLRVMREAHEEGLPVMRPLF
LEFPDDERTWSVDDAYLFGRDVLVAPVLEAGVTRWSTYLPAGARWTDAWTGETYEGGWPV
TVDAPLERIPVFLRDGASVPIAG
Download sequence
Identical sequences C9Z266
gi|290957035|ref|YP_003488217.1| WP_013000346.1.11737 WP_013000346.1.15999 WP_013000346.1.2165 WP_013000346.1.21818 WP_013000346.1.32552 WP_013000346.1.82449 WP_013000346.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]