SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290957041|ref|YP_003488223.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290957041|ref|YP_003488223.1|
Domain Number 1 Region: 16-370
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.55e-112
Family Amylase, catalytic domain 0.000000502
Further Details:      
 
Domain Number 2 Region: 397-601
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.14e-47
Family A4 beta-galactosidase middle domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|290957041|ref|YP_003488223.1|
Domain Number - Region: 607-645
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00695
Family alpha-Amylases, C-terminal beta-sheet domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290957041|ref|YP_003488223.1|
Sequence length 663
Comment beta-galactosidase [Streptomyces scabiei 87.22]
Sequence
MPGETRPSLAAVTRGRVLFGGDYNPEQWPEEVWHEDVRLMREAGVTTVTLGVFSWAKLEP
RPGAREFGWLDTLMDLLHASGVGVVLATPTSSPPPWMGRLHPETLPRDENGQVEWWGSRQ
HFSHSSATYRRYAAAITEDLAARYAGHPALTLWHINNEYCTYDWGDEAAAAFRDWLRRRY
GTLDALNRAWGTAFWSQSYDGWHEIIPPRRAHYLRSPTHVLDFRRFTSDMLLECYAIERD
IVRRHTPHIPVTTNFMPMWAGQDAWRWAGEEDVVSVDIYPDPRDPLGAQHGALVQDMTRS
QAGGGPWMLMEQAAGPVNWRGVNHPKPRGLNRLWSLQAVARGADAVCFFQWRQSRQGAEK
FHSGMVSHAGEQGRTYQEVKRIGAELAAVGPAVAGRPLHAEVAVLFDWHSWWAGDHDGRL
SSEVDLAEVVRSWHRALWESNLTTAFAHPGHDLSAYRMVVVPQLYLLTDAAVENLLAYVR
GGGTLVSGFLTGVADEDDRVRPGGMDARLRDLFGIRTLHERWPLDAGEEVGCAGPRGVFR
GSLWSEEIEAADADETFAYKGGELDGHPALLRRGRAWYVSTLPEPAALRDLLAGVAADAG
VRPVLDGLPDGVEAVRRGDVLFVLNHGRDAVTVEVPGTLHDLLTGAVVTGTLSLGRYGVA
ALR
Download sequence
Identical sequences C9Z272
gi|290957041|ref|YP_003488223.1| WP_013000352.1.11737 WP_013000352.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]