SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290957237|ref|YP_003488419.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290957237|ref|YP_003488419.1|
Domain Number 1 Region: 335-465
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.7e-35
Family Ricin B-like 0.00044
Further Details:      
 
Weak hits

Sequence:  gi|290957237|ref|YP_003488419.1|
Domain Number - Region: 21-74
Classification Level Classification E-value
Superfamily Cupredoxins 0.0608
Family Multidomain cupredoxins 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290957237|ref|YP_003488419.1|
Sequence length 466
Comment hydrolase [Streptomyces scabiei 87.22]
Sequence
MSLWTSLEPASATVDPGSSTTVRLRLRNTGDVVDEYRFEPVGDIAPWTRVEPQTLRLYPG
TTGSVELTFAPPRTPDATAGPNPYAVRITPTQHPEATTVPEGNLTITPFTEVRAELVPPT
VKGRLRGRPKLAIDNLGNTKVTASVSGSDNGDQLSYDLHPSNVQIEPGRAAFVKATLKPR
RIIWFGSKEERPYALAVQRAGVAPHPVDGTYVQRGFLPGWLATCLGVAVALAVTFVTLWF
AYQPRVTSAATDLRQAGTTALPSGSPSAMAPAPSISAAPLPSQTPEAPPEEKQEERPEDP
GPDSGSGGSGSGSGGSGSGSQQEPDTKPTTKKPAAAKGFAIIGKGSDRCVDVTDAKNGKG
KDGTPLQIWDCAGTANQKWDFRGDGTVRSLGLCMDVAWGSRDDGAVIQLARCSGNPAQQF
VLSTAGDLVNPQADKCVDVKDNATGDGGRLQLWTCSGTPNQKWRVK
Download sequence
Identical sequences C9Z6S0
gi|290957237|ref|YP_003488419.1| WP_013000542.1.11737 WP_013000542.1.12502 WP_013000542.1.57887 WP_013000542.1.93747 WP_013000542.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]