SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290957261|ref|YP_003488443.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290957261|ref|YP_003488443.1|
Domain Number 1 Region: 147-482,511-589
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.99e-134
Family Amylase, catalytic domain 0.000000209
Further Details:      
 
Domain Number 2 Region: 3-148
Classification Level Classification E-value
Superfamily E set domains 2.4e-37
Family E-set domains of sugar-utilizing enzymes 0.0074
Further Details:      
 
Domain Number 3 Region: 602-712
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.09e-18
Family alpha-Amylases, C-terminal beta-sheet domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290957261|ref|YP_003488443.1|
Sequence length 715
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MWPGAPTPLGARFRVGPDGVAGTNFALWAGGAEAVELCLFSAAGEETRLRLTELTHEIWH
GFVPGVLPGQRYGYRVHGRWDPWTGARWNPAKLLLDPYARAVDGEFGLPPEVYAHVRDWP
EQHVADTVRDERDSAPHVPKGVVVHDDTPDDEWTDDRRPKTPWADSVIYELHVRGFTMTH
PGVPEELRGTYAGLAHPAAIEHLVKLGVTAVELLPVHQFAHEDHLLRRGMRNYWGYNSVG
YFAPHAAYSSSGTAGQQVGEFRRMVRALHAAGIEVVLDVVYNHTAEADERGPSLSLRGID
NRGYYRLQSDARRYADYTGCGNTLHVVQPHVLRLITDSLRYWVTEMGVDGFRFDLAAALA
RSMHDVDMLSPFLAVIAQDPVLRRVKLIAEPWDVGSGGYQVGAFPPLWTEWNDRYRGAVR
DFWRGALPDVRDLGYRLSGSSDLYAWGGRRPYASVNFITAHDGFTLRDLVSYERKHNEAN
GEGNRDGSDDNRSWNCGAEGETDDEGVRALRRRQLRNLLTTLLLSTGVPMLVAGDELGRT
QGGNNNAYCQDNEISWIDWSLLEDPAWKALFDLTSRLIALRQAHPVLRRRAFFSGRAHSA
DGLRDLAWFTARGDEMTERDWYAPAATLGMYLSGRDIPGRDARGTPILDDSFLIVLHAGD
RPAGFVLPGAPWARRYEVVVDTSREEQGEPVGEVHEAGAEVAVPGRCVLLLRVLG
Download sequence
Identical sequences C9Z6U4
WP_013000565.1.12502 WP_013000565.1.21818 WP_013000565.1.93747 gi|290957261|ref|YP_003488443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]