SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290957275|ref|YP_003488457.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290957275|ref|YP_003488457.1|
Domain Number 1 Region: 232-590
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.05e-83
Family Amylase, catalytic domain 0.0051
Further Details:      
 
Domain Number 2 Region: 594-671
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000183
Family alpha-Amylases, C-terminal beta-sheet domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290957275|ref|YP_003488457.1|
Sequence length 695
Comment alpha-amylase [Streptomyces scabiei 87.22]
Sequence
MTPESAPASPARPAHAGPPAPAAPPSKTPGTPGAPTIGRIPVVDVRPTVHHGRRPAKAVV
GEAFEISAVVIREGHDAVAANVVLRDPEGRPADWAPMRELAPGTDRWGATVSVPSEGVWS
YAVEGWGDPVTTWRHHARIKIPAGMDTELVLEEGARLHERAADGVPEGRSGRSVLLSAVD
ALRDTARPVSSRLAAALAPEVDEVLARHPLRELVTSSEPLPLLVERERALFGSWYEFFPR
SEGTPAQPHGTFRTAARRLPAIAAMGFDVVYLPPIHPIGTTFRKGRNNTLSPTPDDVGVP
WAIGSPEGGHDAVHPDLGTLDDFDHFITRARSLGMEIALDFALQCSPDHPWVSKHPEWFH
HRPDGTIAHAENPPKKYQDIYPIAFDADLPGLITETTRILRHWMDHGVRIFRVDNPHTKP
VVFWEQVIADINATDPDVIFLAEAFTRPAMMHTLAATGFQQSYTYFTWRTTKQELTEYAT
ELAGEAAAYMRPNFFVNTPDILHAFLQEGGRPAFELRAVLAATLSPTWGIYSGYELCENT
PLKPGSEEYLDSEKYQLRPRNWDTAARDGRTIAPLIGKLNEIRRRSPALRQLRDLHFHHA
DQEAVIVYSKRAGSNTVLVVVNLDPHHTQEATVSLDMPHLGLDWHESVLVRDELTGEVYT
WGRNNYVRLEPGRSPAHVLTVLRPSNPQIGGSPTS
Download sequence
Identical sequences C9Z6V8
gi|290957275|ref|YP_003488457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]