SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290957278|ref|YP_003488460.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290957278|ref|YP_003488460.1|
Domain Number 1 Region: 500-943
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.76e-111
Family Amylase, catalytic domain 0.0000000021
Further Details:      
 
Domain Number 2 Region: 949-1052
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.08e-29
Family alpha-Amylases, C-terminal beta-sheet domain 0.00022
Further Details:      
 
Domain Number 3 Region: 340-435
Classification Level Classification E-value
Superfamily E set domains 9.27e-18
Family E-set domains of sugar-utilizing enzymes 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290957278|ref|YP_003488460.1|
Sequence length 1053
Comment 1,4-alpha-glucan-branching protein [Streptomyces scabiei 87.22]
Sequence
MKKTAAKKTAAKKAVAKTATAKKTATKKAAQESTKKSVEVEAAVGEPAPGRAAGTGGATA
KAPAKKTAATKKAVAKKAATKKAVVKTAATKTAAATKTPAKSAASKKAAAAKSVAEKAQV
EEAVAEKAVAESAVTAEAAAEKPLAKKAVTKKAAAKKAAAKKPVAKRVAAKTAAVRKTPA
VKKTAAVKEPATVEKTAAKKAGVKKAGVKKQAAARKATPPEDVVTTEAAARRAVAGKAVT
SPRQAERAVLVPALPPGGGTPPPAPVSAGSPAPEPVLPQQAAAEPAVPPRAAAEPASPHP
SVPRQETPAQDTAPHDDPALAHPVVSPAMDGGDRERLLAGTHHAPHSVLGAHPVPGGVVF
RVFRPYALGVSVVVDTLRAELHDDGGGFYSALLPLREVPSAYRLLVSYEGAVQETEDAYR
FLPAIGELDLYLIGEGRHEELWKALGAEPMTHQGVTGTRFTVWAPNALGVRLAGTFNFWD
ATGYPMRALGSSGVWELFVPGIGEGELYKFEITRPDGSKTLRADPMARRTEVPPNTSSVI
HASGYEWNDEEWLARRTQTPAHEAPFSVYEVHLPSWRPGLTYRQLAEQLPAYVSDLGFTH
VELLPIAEHPFGGSWGYQVTGFYAPTARLGTPDDFKYLVDALHRAGIGVLMDWVPAHFPR
DDWALAEFDGRPLYEHADPQRAAHPDWGTLEFDYGRREVRNFLVANAVYWCEEYHIDGLR
VDAVASMLYLDYSREPGQWTPNEHGGRENLDAVAFLQEMNATVYRRVPGVVTIAEESTAW
DGVTRATHHNGPGGFGGLGFGLKWNMGWMHDSLDYMAKDPVHRKHHHHEMTFSMVYAYSE
NYVLPISHDEVVHGKGSLVSKMPGDWWQRRANHRAYLGFMWAHPGKQLLFMGQEFAQGAE
WSEAHGPDWWLLDPAYGAEADHRGVRDLVRDLNAEYRRTPALWQQDTRPAGFSWITGDSA
DDNVLAFLRFAEDGTPLLAVSNFSPVVREEYRLGVPEDVPAWREVLNTDAAAYGGSDSTG
SAPVKPDPQPWHARPASIRVTLPPLSTVWLRPA
Download sequence
Identical sequences C9Z6W1
gi|290957278|ref|YP_003488460.1| WP_013000582.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]