SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290957474|ref|YP_003488656.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290957474|ref|YP_003488656.1|
Domain Number 1 Region: 4-281
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.85e-38
Family Glycosyl hydrolases family 32 N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290957474|ref|YP_003488656.1|
Sequence length 453
Comment hypothetical protein SCAB_29941 [Streptomyces scabiei 87.22]
Sequence
MRYAPPGLCVNDFALLRDDDGTYAVLHLQGPWTADFDHLRMETSYGRATSADLVGWRPEG
TAFGNGLPGRFDQRAVWTMHPFRHGAGMAMLYTGVSGLTPEGWPLQSVGLAYSDRTDGTG
WRRHGTSPVVEADPRWYRTADRMGWRDPFVVRDDEGDGWAMVICASDASLPVEVSGCVAL
ATSTDLEHWTVHPPLISPGDVDELECPVLERLDDGSWLLLGSIGATRGFEAWTAPRLRGP
WTRRGTLGPTGAYAPRVIAAPDGSRVVLHTTPRRVGLTDTGDHCRGMLAQPKSLVTEEGS
APRLMWWPGLDDWLGEETHAPVPHAVGEVEIGAGPVDVTLRSATLGPGRAGSPALGVGCD
GKNLRITGAAGTPLAETVLPEPAATLRILTVGEYVEVYADGVFVLTALSYTGAPAPWTAV
AGERTWTVPVRPLRLPAPDRDDASAVWPGPDAS
Download sequence
Identical sequences C9ZAA5
WP_013000775.1.94791 gi|290957474|ref|YP_003488656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]