SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290958741|ref|YP_003489923.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290958741|ref|YP_003489923.1|
Domain Number 1 Region: 211-568
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.35e-78
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000144
Further Details:      
 
Domain Number 2 Region: 47-188
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.86e-42
Family Ricin B-like 0.0019
Further Details:      
 
Domain Number 3 Region: 578-882
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.18e-38
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290958741|ref|YP_003489923.1|
Sequence length 884
Comment hypothetical protein SCAB_43081 [Streptomyces scabiei 87.22]
Sequence
MNNPTNGGRRGRHRRRWTATAVLLGAPLAVVPYLLFTQEDSQAATIDGDAFYKLVSVRSG
KVLDVNGFSTADGTRIQQWTDQNTANQQWRLKPAGGGYYELVNRNSGKVLGVTGNSTAKS
AATEQQTDSSATSQEWRIDDVSGASGAVTLTSRRSGQVLDVSGASTAQGAAVIQYPGKGG
AHQQWKLVKVGGTGASGTGGTQVPARTGPYVWKNAQVVGGGYVTGLVFNQKEKGLLYART
DMGGAYRWDTGAEQWIPLTDWIGEKDWNLLGIDSLATDPVDPDRLYLGAGTYTNDWAGNG
AILRSTDRGRTFKRTELPFKLGGNEDGRGAGERLVVDPADNGTLLLGTRKNGLWRSTDHG
ASWKQVSSFPVKDGAGSGAGISFVTYGKAGSGTIYVGVADKSASLYRSTDGGTTWQTVSG
QPTGQLPQHGVLSGDGSLYLTYTNALGPNGVTGGSVWKYAPATGAWKDISPSQGSYGFSG
LAVDPRKPSTVMVTTLGRWWPEDEIYRSTDGGANWKALADKSVRSASAAPYVGTHTGHWM
TALAIDPFDSGHALYGTGNGILRSKDADASDSGGTSHWAMGARGLEETALMDAIAPPGGA
AVVTAMGDQGGFRHDSLTKVPSGRLDNPMMSNSTDIDFAQSKPSTMVRVGRGGAQDGAYS
TDGGASWKGFKAEPVPSAQDGHIALSADGSTIVWTEAGEAPYRSTDNGASWSRAGGLGSG
AVVVADRSSARTFYSLSGGTLHASTDGGATFTARADNLPSGRLTAVPGVAGDLWIAGGGK
GLLHSTDGGRTFTTLTSVRSASALGFGKAASGADYQALYLIGTVKDVTGVFRSTDKGATW
LRVNDDAHQWGAIGGVGVVTGDPDTFGRVYVGTNGRGLQYGDPS
Download sequence
Identical sequences C9Z5M3
WP_013001989.1.11737 WP_013001989.1.94791 gi|290958741|ref|YP_003489923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]