SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290958794|ref|YP_003489976.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290958794|ref|YP_003489976.1|
Domain Number 1 Region: 56-436
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.55e-37
Family Family 1 of glycosyl hydrolase 0.029
Further Details:      
 
Domain Number 2 Region: 540-678
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-20
Family Ricin B-like 0.0046
Further Details:      
 
Domain Number 3 Region: 445-525
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000482
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290958794|ref|YP_003489976.1|
Sequence length 684
Comment hypothetical protein SCAB_43661 [Streptomyces scabiei 87.22]
Sequence
MAHRTRTRRLFGAIGVTALATGTVMATTSLPMAHADTAAVASVTVRPDPSYKADSFEGWG
TSLVWFANATGDYPPAVREKLADLLFGKDGLDLNIARYNIGGGNAPDVKDYLRAGGAVEG
WWKAPAGTTRTDVDWWDADDKNDWNKDADATQRWWVDRIKNDIDHWETFSNSPPWFMTES
GYVSGGFDSTKDQLKADSVDDFAKYLVGATERLEKAHHIKVDTLDPFNEPNTNYWGTKLG
ADGQPTGGRQEGAHIGPELQQKVIKALAPVLKKSRSDAEISAMDETNPSIFATNWNSYPK
EVRDLVGQMNVHTYGTGQRTMVRDLAKAADKPLWMSEVEGDWGDGQSFTDMRPGLGLAQQ
MVDDLRELEPQAWVFWQPVEDYDNMKPGGESAKGGNWGSIQMSFSCKSSDTLKSCPIYTN
TKFDTARNFTHYIKPGDRLIKTDDKSSTAAVAKKGKKATVVHVNSTTAPRAVTLDLSRFG
DVGKHARVTPVVTDASGKLVRQKAVDVRDKKATITVPAQSVTSFLISSVSGVAASAAELQ
DDHTYTLNGVQSGKNLALAADGKSLVIKNPNAATAAQRWTLDRVGTGPTGNRTRYVLTEA
ASHKRLAVRGGSLVAEPDTGARDTATQWILSSTGDSTWTLVNTATGQLADVGGQSTNDGA
GVGLWIPNSGTNQRWKLTDVTPAS
Download sequence
Identical sequences C9Z737
WP_013002041.1.11737 WP_013002041.1.12502 WP_013002041.1.21818 WP_013002041.1.57887 WP_013002041.1.93747 WP_013002041.1.94791 gi|290958794|ref|YP_003489976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]