SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290958857|ref|YP_003490039.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290958857|ref|YP_003490039.1|
Domain Number 1 Region: 46-330
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.72e-70
Family Amylase, catalytic domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 521-645
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.6e-40
Family Ricin B-like 0.0000235
Further Details:      
 
Domain Number 3 Region: 332-419
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000216
Family alpha-Amylases, C-terminal beta-sheet domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290958857|ref|YP_003490039.1|
Sequence length 647
Comment hydrolase [Streptomyces scabiei 87.22]
Sequence
MIRAVTLATAATAALIFAQPPTAAPTPRTLTDIAPVAVTDRQIPVPEAPMGWASWNAFAA
KVDYDVIKKQVDAFVAAGLPEAGYEYINIDEGWWQGTRDSAGNITVDEAEWPGGMKAIAD
YIHSKGLKAGIYTDAGKDGCGYYFPTGRPAAPGSGSEGHYVQDMTRFSQWGFDFVKVDWC
GGDAERLDPKTTYQAISDAVATATATTGRPLALSLCNWGYSNPWNWAPGMGPMWRTNTDI
FYHGQGLTYAGMLTNYDRNVHPTAQHTGYYNDPDMLMIGMGLTAAQDRTHMNLWAISGAP
LLAGNDLSTMTTETANILKNSEVIAVDQDPRGLQGVKVAEDTTGLQVYGKVLSGTGNRAV
VLLNRTSTTQNMTVRWSDLGLTNASATVRDLWSRTDVGTPGTSYTTSVPAGTSVMLTVKG
GTEQASSTYTGTSSFSGVVAGNTGLKTVDVSYTNNTSTARVGTLTVNGQTSTKVSFPPTG
SSPGTISVALSLTKGSANTITFTGAPTLEGIVVRPLPGTNGTLITGTGSGRCADIDNNTI
TNGTDAQLWDCSGGQNQVWQYTSRKELVVYGNKCLDAWDRGTSNGTRVVIWDCHGGTNQQ
WHVNADGTIVNVNSGLCLDAYNAATANGTKLVLWSCNGQNNQKWSRT
Download sequence
Identical sequences C9Z7A0
gi|290958857|ref|YP_003490039.1| WP_013002103.1.11737 WP_013002103.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]