SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290959965|ref|YP_003491147.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290959965|ref|YP_003491147.1|
Domain Number 1 Region: 246-582
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.22e-90
Family YicI catalytic domain-like 0.000000000197
Further Details:      
 
Domain Number 2 Region: 1-245
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.34e-61
Family YicI N-terminal domain-like 0.000000561
Further Details:      
 
Domain Number 3 Region: 584-662
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.96e-20
Family Putative glucosidase YicI, domain 3 0.00014
Further Details:      
 
Domain Number 4 Region: 664-728
Classification Level Classification E-value
Superfamily Putative glucosidase YicI, C-terminal domain 0.000000000157
Family Putative glucosidase YicI, C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290959965|ref|YP_003491147.1|
Sequence length 760
Comment O-glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MKFTDGYWLLREGVTAAHPVEVLDVTVTDGTLRVHAPTRPVRHRGDLLKGPVVTIDAHAP
MPDVIGVTFTHFEGERPRGPRFELTTEEFTPHTSYDDEHATLTAGELSVRVSRTGPWRVD
FLAHGRTLTTSGPRSMGIMREASGAHHLREQLNLGVGTSVYGLGERFGPLVKNGQTVDVW
NADGGTATEQAYKNVPFYLTDAGYGVFVDHPGRVSFEVASEVVSRVQFSAETQQLTYYVI
YGPTPKEILRKYTALTGRPALPPAWSFGLWLSTSFTTSYDEETVTSFIDGMRERRLPLSV
FHFDCFWMREFQWCDFTWDPRVFPDPEGMLARLKRRGLRISVWINPYIAQRSPLFAEGRD
LGHLLCRPDGDVWQWDLWQPGMALVDFTSPAARAWYASKLEALLAQGVDCFKTDFGERVP
LDVAWSDGTDPERMHNYYTYLYNRTVFDVLRKHRGEGEAVLFARSATAGSQSFPVHWGGD
CESTYEAMAESLRGGLSLGLSGFGYWSHDIGGFEGTPTPALFKRWIAFGLLSSHSRLHGS
SSYRVPWLFDDESVDVLRAFTRLKLGLMPYLHQAARTAHTEGVPMMRAMVLEFPDDPGCA
HLERQYMLGPDLLVAPVFSDEGDVTYYVPEGTWTRFADGGTVTGPRWVRERHDFTSVPLL
VRPGAVVPVGAVTDRPDYDYADGVTLRAYGLAHGARVTVPVGDVTFTVVREGRVLRASCG
NPRAPWGLAAGGREVRAEAGTGFVTMDLDEESAPAGTRKP
Download sequence
Identical sequences C9Z0Z6
gi|290959965|ref|YP_003491147.1| WP_013003178.1.11737 WP_013003178.1.12502 WP_013003178.1.15999 WP_013003178.1.2165 WP_013003178.1.21818 WP_013003178.1.32552 WP_013003178.1.57887 WP_013003178.1.82449 WP_013003178.1.93747 WP_013003178.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]