SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290961026|ref|YP_003492208.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290961026|ref|YP_003492208.1|
Domain Number 1 Region: 36-375
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.23e-84
Family Amylase, catalytic domain 0.0000000758
Further Details:      
 
Domain Number 2 Region: 378-456
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.44e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290961026|ref|YP_003492208.1|
Sequence length 460
Comment alpha-amylase [Streptomyces scabiei 87.22]
Sequence
MTSRTLSGALALAAGASIALTAPAGSAYASPPGTKDVTAVLFEWNFASVARECTSTLGPN
GYGYVQVSPPAEHIQGAQWWTSYQPVSYRIAGRLGDATAFKNMIDTCHAAGVKVVVDTVV
NHMSAGSGTGTGGSSYTKYDYPGLYSSFDFDDCTATISDYTNRANVQNCELVTLADLDTG
EEYVRSAIAGYMNSLLGYGVDGFRIDAAKHIPAADLANIKSRLTNSSVYWKQEAIHGSGE
AVQPGEYTGNGDVQEFRYAFDLKRVFTNENLAYLKNYGEGWGYMNSSVAGVFVDNHDTER
NGSTLSYKDNATYTLANVFMLAYPYGAPDINSGYEFSSTDAGPPDNGRVDACWQNGWKCQ
HAWPEIMRMVAFRNATRGEAVTDWWDNGSDAIAFGRGGKGFVAINHESSGLSRTYRTSLA
AGTYCNVQNNTTVTVNGSGQFTATLGAHTALALYAGKSSC
Download sequence
Identical sequences C9ZHE6
WP_013004224.1.11737 WP_013004224.1.12502 WP_013004224.1.15999 WP_013004224.1.2165 WP_013004224.1.21818 WP_013004224.1.32552 WP_013004224.1.57887 WP_013004224.1.82449 WP_013004224.1.93747 WP_013004224.1.94791 gi|290961026|ref|YP_003492208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]