SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290961401|ref|YP_003492583.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290961401|ref|YP_003492583.1|
Domain Number 1 Region: 27-322
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.09e-69
Family alpha-L-arabinanase-like 0.0000608
Further Details:      
 
Domain Number 2 Region: 329-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-25
Family Beta-D-xylosidase C-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290961401|ref|YP_003492583.1|
Sequence length 536
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MSDTATATAAGAVTAAAFSADRGDGTYRNPVLDADWSDPDVLCVGDDFYLTASSFGRAPG
LPLLHSRDLVNWTLVGHALELLEPASEFRAPRHDCGVWAPSLRHFDDRFWIFWGDPDQGV
FQVNAPGIRGPWTRPHLVKEGKGLIDPCPLWDEETGEAYLVHAWAKSRSGIKNRLTGHRM
RPDGTGLLDEGRVVVDADRLPGWFTLEGPKLYRHDGWYWIFAPAGGVETGWQGVFRSRGF
FGPYEEHIALEQKDTEVNGPHQGGWVRTAAGEDWFLHFQQRGAYGRVVHLQPMRWDRADG
WPVIGDDGAPVAVHRKPALPAQPAAAPATDDDFPGGRFGRQWQWTANPQDGWATQHSGDG
LRLTCVRSVHAHDLRKLANVLTQRLPGIPASIEVGLRLDSEEPGARAGLAVLGDAFRWIG
LQRESDGSVRLVHRFAETVAVGERDAGPPRPAPEGRARLRIETAAGARCRFSYDVGEGWE
SSGQVFAAAPWRWVGALLGLFAVAPTGGGHAGAATFTRFRITAARATTAAARATTA
Download sequence
Identical sequences C9YYE2
gi|290961401|ref|YP_003492583.1| WP_013004593.1.11737 WP_013004593.1.12502 WP_013004593.1.15999 WP_013004593.1.2165 WP_013004593.1.21818 WP_013004593.1.32552 WP_013004593.1.57887 WP_013004593.1.82449 WP_013004593.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]