SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290961751|ref|YP_003492933.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290961751|ref|YP_003492933.1|
Domain Number 1 Region: 200-554
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.85e-62
Family beta-glycanases 0.0024
Further Details:      
 
Domain Number 2 Region: 73-216
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000312
Family CBM4/9 0.036
Further Details:      
 
Domain Number 3 Region: 640-727
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000136
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number 4 Region: 735-825
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000156
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290961751|ref|YP_003492933.1|
Sequence length 827
Comment alpha-N-furanosidase [Streptomyces scabiei 87.22]
Sequence
MSRNTRARWRLGLTATALLTTAALIPAPAHAEDVTDYAITVDPSTEGAKIDDTMYGVFFE
DINRAADGGLYAELVQNRSFEYSTADNRAYTPLTSWSVDGTARVVNDAGRLNERNRNYLS
LGAGSAVTNAGYNTGVRVEKGERYDFSVWARAESRTALTVMLQDADGALAEAAEVTVKGG
WAKYKVRLRATRTSSTGRLTVAAAGAAALDEVSLFPRDTYKGHRNGLRADLAEKIAALEP
GFVRFPGGCLVNTGSMQDYSAASNWERKRSYQWKDTIGPVEQRATNSNFWGYNQSYGLGY
YEYFQFSEDIGAMPLPVVPALVTGCGQNRATEDEALLQRHIQDTLDLIEFAGGPVTSEWG
AKRAEMGHPEPFHLTHLAVGNEENLPNEFFAHFKKFRAAIAAKYPDITVISNSGPDDTGA
TFDTAWKLNREAKVDMVDEHYYNSPQWFLQNNDRYDSYDRSGPKVFLGEYASQGNAFKNA
LSEAAFMTGLERNADIVKLASYAPLLANEDYVQWSPDMIWFNNHASWNSANYENQKLFMN
NVGDRVVPSTATGTPALSGPITGAVGLSTWATTAAYDDVKVTAADGTTLLTDDFGGDASQ
WTHTGRGSWSIQDGQYTQTDVAAENTMVSAGDTAWHDYDLKVKATKKAGKEGFLVAFGVK
DTGNYYWWNLGGWNNTTSAVEQAVDGGKSSLISKPGTIETGRAYDIEVEVRGRKVTLLLD
GKEWGSFTDDKPAEPFRQVVTRDAETGELIVKVVNAQPSAARTSIDLGTARVRSTAHVTT
LTAAPDAVNTETATPVAPVRSTFGGVAEKFSYTFPANSVTFLRIKKR
Download sequence
Identical sequences C9Z4J7
WP_013004937.1.11737 WP_013004937.1.94791 gi|290961751|ref|YP_003492933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]