SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290961914|ref|YP_003493096.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290961914|ref|YP_003493096.1|
Domain Number 1 Region: 14-248
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.88e-61
Family Glycerophosphoryl diester phosphodiesterase 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290961914|ref|YP_003493096.1|
Sequence length 255
Comment phosphodiesterase [Streptomyces scabiei 87.22]
Sequence
MTDRVRHPYLDHPGPIAFAHRGGAADGLENTAAQFRQAVKSGYRYIETDVHATLDGKLVA
FHDATLDRVTDGAGRIMDLPWKEIRQARVAGVEPVPLFEDLLEEFPEVRWNVDLKAESAL
HPLLNLIARTGSFDRVCVGSFSEARVARAQRLAGPRLATSYGTGGVLGLRLRSWGVPAAL
RRTAVAAQVPEAQAGVPVVDHRFVRAAHARGLQVHVWTVNEPQRMHGLLDLGVDGIMTDH
IDTLRKVLEDRGTWV
Download sequence
Identical sequences C9Z7R2
WP_013005092.1.11737 WP_013005092.1.15999 WP_013005092.1.2165 WP_013005092.1.21818 WP_013005092.1.94791 gi|290961914|ref|YP_003493096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]