SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290961944|ref|YP_003493126.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290961944|ref|YP_003493126.1|
Domain Number 1 Region: 279-628
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.36e-75
Family YicI catalytic domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 630-709
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.01e-20
Family Putative glucosidase YicI, domain 3 0.02
Further Details:      
 
Domain Number 3 Region: 86-274
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000289
Family YicI N-terminal domain-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290961944|ref|YP_003493126.1|
Sequence length 790
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MDGRDLVRSVKAIGSAGVAEGLRAARAAWRGRRADAAALPARGAERARVPGAVVGAEPGP
GGGVVRFGRSALRVTVDVNGAVFWGWDGAGPEPSYALAGRCPEPDPRVVLEPDKDGGWRV
VAERVTVVVSRLGAVEVCTPGGVTLRRDLPPRWWEPVGAGEARWVQRSEVGADARFFGLG
GRAAGPRLRGGTYRLWNTDPGRPSVPGDDPLYLTMPVQMVVADAGTHLVFHDTTWDGTVT
LREGEEGAGSGHDRAGASELRMDGGPLRCWVIVGTPARVLHAWAALTGAPALPPAWALGH
HRAGWGLGDEQEVRRTVAGYREHGLPLDAVHLDAGHQERRQAFTVDTERFPKLPDLAEAL
RRDGIRLVSVVDPAVRARPGDAVYDAGTAGDAFVRDAAGQVVRCVVRPGESVYPDFTRPA
TRAWWGGLHEERLAQGFAGFWHDRNEPTSFTAFGGHTLPRSARHDLEGRGGDHREAHNVY
ALCMARAAYEGLRELVPRERPFVLSRSGWAGVQRYGGTWSGDVATGWAGLRASLALALGL
GLCGVPYAGGDVGGSDGGASEELYLRWLQLGAHLPLFRTRAGAGAGAGRREPWEFGEGVV
GHARAALVERRRLLPYFMTLAHLARRTGAPYVRPLWWGAPEDRALRDCEDAFLLGDALLV
APVLEPGVERRAVRLPRGLWYDTVTGQAYQGPGQVLLDAPLSRIPVLARAGAVLPVRGAD
GGLELEVWAPARGRTGSGLVVPDAGDGWDEPEVERYTARRQGARVVVERDGDEGPAEPAY
PVRVRGLGQG
Download sequence
Identical sequences C9Z9B8
WP_013005121.1.2165 WP_013005121.1.94791 gi|290961944|ref|YP_003493126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]