SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962202|ref|YP_003493384.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962202|ref|YP_003493384.1|
Domain Number 1 Region: 41-417
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-28
Family Family 1 of glycosyl hydrolase 0.086
Further Details:      
 
Domain Number 2 Region: 520-657
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.96e-20
Family Ricin B-like 0.014
Further Details:      
 
Domain Number 3 Region: 829-960
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000293
Family Galactose-binding domain 0.072
Further Details:      
 
Domain Number 4 Region: 425-507
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000226
Family alpha-Amylases, C-terminal beta-sheet domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290962202|ref|YP_003493384.1|
Sequence length 1049
Comment hypothetical protein SCAB_78891 [Streptomyces scabiei 87.22]
Sequence
MVPLVLGAGLTAAPPAAADTTAPARNSVTVRIDPSYQQQEFEGWGTSLVWFANATGGYPE
PVRRRLVDMLFGEDGLRLNIARYNIGGGNAPDVRKDYMKTGATMDGFWKAPPGTTRQDME
WWDPENPGHWDWNADQGQRWWVDQVKDKITKWEAFSNSPPWFQTVSGYVSGGFDANTDQI
RADRVDEFAAYLVRVTEEMEKRHGIDFDTIAPLNEPNTNYWGTQIGANGQPTGGRQEGAH
AGPALQQKVLLALQNALRGARTDARISAMDETNPTIFTQNWNAYDASARAAVPQLNVHTY
GTGMRTSARDIAKGADKKLWMSEVEGTWGTGSDFTGMEPGLGIAGRMVDDMRELEPSAWV
FWQPVEDALPQAAAGKNWGSIHVPFNCTATDTLETCPIRANSKFDTIRNFTHHIRPGDHF
VKVDDPSSVAAVRKSGRSATVVHVNGGTTARSVTLDLSRFRKIDAGATVTPVVTSAGGAL
VKGTPVAVTGGSATLDVPAKSVTTFLVEGVRGADKDAALVQPGHVYRLQGTQSGKSFAPS
PDGTGVVLRTTDAASARQLWSVEQLTSGTGNRERYTLTNADTGGRLAVRDNQAVLEEAGA
GEVPAAAQWLMSTTGDGSWTLVNAATGRLLDVIGQSSADGAKVSTYTPTSAANQLWAVSD
ETVLSTERAEAFTVPGLRPKLPETVTPVVRDGARGSLPVVWELPADRKWRKSGTVRVQGE
ATDVLGRRIPAEARVTVDTIASTVPGRAKTYEGGEPELPATVTGVGRDGGRTALPVTWDR
AADGAFDEKGVVTLTGRAEVVDGSTVDAAVRVQVTRASETNIAPDPGVGVAATYTESGYS
AERLRNGNTAEKAWSNWRSGTKNPSDTITFGLPKARDLSRVVAHFHRDGTNVSFPQSLKI
QVRKTADGPWTDAGGPVTVGTEGTPVIDVPLDAGPVTGVRVVMTARQGGYITMGEIEVYA
KAPGVSSDAAASSVEVDGKPVGSFDPGTTDYRVVTDDPGRAEVTATARDPYAAVTVDRSD
ASGGASAVVTVRGEDGSQTRKYRIELVRG
Download sequence
Identical sequences C9ZCR4
WP_013005304.1.11737 WP_013005304.1.94791 gi|290962202|ref|YP_003493384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]