SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962233|ref|YP_003493415.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962233|ref|YP_003493415.1|
Domain Number 1 Region: 38-178
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.81e-46
Family Ricin B-like 0.0026
Further Details:      
 
Domain Number 2 Region: 212-479
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.55e-29
Family alpha-L-arabinanase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290962233|ref|YP_003493415.1|
Sequence length 492
Comment arabinofuranosidase [Streptomyces scabiei 87.22]
Sequence
MWFRHLSPVSPRRLLAVLSPLLLVAAFLGAQPAAAATVDPNASYVLVNRNSGKALDVHNR
ATDDGARITQWTRNDQAQQQWQFVDSGGGYYRVKSRHSGKVLDVHNLSTANGGSIVQWAD
LNGTNQQWRLADSSDGHVRLIARHSGKALEVQGAGTADNANVVQYDDWGGTNQQWQLVKV
GGDGSGPCDLPSSYRWTSTGALAQPRAEWASLKDFTVAPYNGRQLVYATTHGAAGTGKAW
GSMNFGLFTNWSEMASASQNTMSSGTVAPSLFYFAPKNIWVLTYQWGATAFSYRTSTDPT
NPNGWSAPQPLFSGSISDSGTGPIDQTIIGDGTNMYLFFAGDNGKIYRAGMPIGNFPGSF
GSSYTTVMSDTVKNLFEAPQVYKVKDRNQYLMIVEARGADEKRYFRSFTATSLNGSWTPQ
AATESNPFAGKANSGATWTNDISHGELLRTSADQTMTVDPCNLQLLYQGRSPGSGGDYGL
LPYRPGLLTLQR
Download sequence
Identical sequences C9ZE94
WP_013005335.1.11737 WP_013005335.1.12502 WP_013005335.1.21818 WP_013005335.1.57887 WP_013005335.1.93747 WP_013005335.1.94791 gi|290962233|ref|YP_003493415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]