SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962234|ref|YP_003493416.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962234|ref|YP_003493416.1|
Domain Number 1 Region: 56-352
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.2e-108
Family beta-glycanases 0.000000000102
Further Details:      
 
Domain Number 2 Region: 357-483
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.35e-42
Family Ricin B-like 0.00000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290962234|ref|YP_003493416.1|
Sequence length 485
Comment xylanase A [Streptomyces scabiei 87.22]
Sequence
MSTLSGGTVMGSYALRGPDVRPKIRGLLLTLLVSVLGTVAALVTPPAAHAAESTLGAAAA
QNGRYFGTAIASGRLGDSAYTTIANREFNSVTAENEMKIDATEPQRGQFNFTAGDRVYNW
AVQNGKQVRGHTLAWHSQQPGWMQSLSGSTLRQAMIGHINGVMAHYKGKIAQWDVVNEAF
ADGSSGARRDSNLQRSGNDWIEVAFRTARAADPAAKLCYNDYNVENWTWAKTQAMYSMVR
DFKQRGVPIDCVGFQSHFNNDSPYNSNFRTTLQSFAALGVDVAITELDIQGASGTTYANV
TNDCLAVPRCLGITVWGVRDTDSWRAEQTPLLFTGGGAKKPAYTSVLNALNGGTPTPPAD
ARPVKGVGSGRCLDVPGSSTTDGTQVQLYDCHTGTNQQWTFTSAGELRVYGNKCLDAAGT
GNGTKVQIYGCWGGDNQKWRLNSDGTVTGVQSGLCLDTASGGTANGTLIQLSSCSGGNSQ
RWSRT
Download sequence
Identical sequences C9ZE95
gi|290962234|ref|YP_003493416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]