SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962246|ref|YP_003493428.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962246|ref|YP_003493428.1|
Domain Number 1 Region: 825-944
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.7e-39
Family Ricin B-like 0.00018
Further Details:      
 
Domain Number 2 Region: 687-814
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-25
Family Family 6 carbohydrate binding module, CBM6 0.00051
Further Details:      
 
Domain Number 3 Region: 38-344,399-478
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 1.31e-23
Family Soluble quinoprotein glucose dehydrogenase 0.0032
Further Details:      
 
Domain Number 4 Region: 498-585
Classification Level Classification E-value
Superfamily PKD domain 6.93e-23
Family PKD domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290962246|ref|YP_003493428.1|
Sequence length 945
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MSMNIRRVAATRWPAIASALLLVAAALTANLSGATPASAHPINAADFQQVQLARGVPEVG
EPMSLAVLADRSVLHTARNGTVRRTDANGTTTVIGTVPVYTHDEDGLQGIGIDPGFATNR
HIYLYYAPPLSTPGGDAPTTGGNWSAWQGVNRLSRFTLNGDFTINQSSKVDILDVSADRG
ICCHAGGDIDFDAAGNLYLSTGDDTNPFESAGYSPLDERTNRNPAFDAQRTAANTNDLRG
KILRIKVNANGSYSIPEGNLFPPGTAKTRPEIYAMGLRNPFRMSVDKATGVVYVGDYGPD
AGSTSARGPQGQVEFNRVTGPGFYGWPYCNGTNTNAETFAEWDFATNTAGAKYNCSGGAT
NNSFRNTGLSTLPPAKAAWIRYGGDAGSPPAFGGGSESPMAGPVYRYDPDLGSPTKFPQS
FDGQFFATEFGRGWIKPIHLNADGSPGTIDSFPWTGKQVIDSAFGPDGSYYVLDYGAGLY
QGDQYSALYRFDYVGGGNRAPTAVAGANRTSGAAPLTVAFSSAGSSDPDGGALTYSWSFG
DGTGSTAANPTKTYDTNGNYTATLTVRDPQGATGTADVRITVGNTAPTVTVDRPAAGEIF
AFGDTVPFAVTVTDPEDGTVDCAKVKMTYIVGHDSHGHPVTSKTGCSGTITIPVDGEHDD
AANIFGVFDAEYTDNAGLTTHTQHILQPKHRQAEHHKTSSGIGILDKSTAEGGKSVGDIE
NGDWIAFEPYRLSNATSFSARVSSAGAGGTLQVRAGSPTGTVLGTATVPVTGSWTNFTTV
NGSVSGAPAGTTTLYLTFAGGSGYLFDVDAFTFDTGGGPSAGPIVGVAGKCLDVRDGSSA
DGAAVQISSCTGAARQQWTVASGSTVKALGKCLDVSGNSTADGAKVQLWSCNGGANQNWQ
ASSDGSLRNPRSGKCLDVNGANSSDGTLVNLWTCHGGANQKWTLP
Download sequence
Identical sequences C9ZEA7
gi|290962246|ref|YP_003493428.1| WP_013005348.1.11737 WP_013005348.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]