SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962249|ref|YP_003493431.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962249|ref|YP_003493431.1|
Domain Number 1 Region: 176-493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-96
Family Alpha-L-arabinofuranosidase B, N-terminal domain 0.0000000428
Further Details:      
 
Domain Number 2 Region: 36-164
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.06e-40
Family Ricin B-like 0.0000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290962249|ref|YP_003493431.1|
Sequence length 494
Comment arabinofuranosidase [Streptomyces scabiei 87.22]
Sequence
MVFRIPRPRWYGRLSALGTALVLVAVGATAVAAPIEPGQSAPLVGAQSGRCLTVPGASTT
NGTQTQLQDCTGTTGQTWTYTTGRQLTVPGNKCLDASGSGTTNGTPVIIWDCNGGTNQQW
NVNPNGTITGVQSGLCLDANAGGTANGTRTILWSCHGGTNQQWNSPPDPPEPGDGGTCDI
YASGGTPCIAAHSTVRALYGTYSGNLYQVRRSSDSTTRNIGVRSAGGAADAAAQDSFCAG
TACVITVVYDQSGRGNDLWYQGSSVVPGSPQSRPATATSESLTVGGSKAYSLYINPGNSY
WRDGHLTGVPTGSAPEGMYMVTSGTHVNGGCCFDYGNSETTRAADAAGAMDAINFSTQCW
FGGCVGRGPWVQADLEWGLYSGGSQSWNTNQRAFTGKFVTAMLKNNGTSRFALRGADAQT
GGLTTLWDGALPPGYSPMKKQGAIILGSGGDCCKPGGGANLSAGTFYEGAMVSGYPSDAT
DNAVQANIVAAGYR
Download sequence
Identical sequences C9ZEB0
WP_013005351.1.11737 WP_013005351.1.21818 gi|290962249|ref|YP_003493431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]