SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962250|ref|YP_003493432.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962250|ref|YP_003493432.1|
Domain Number 1 Region: 1032-1171
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.2e-43
Family Ricin B-like 0.00028
Further Details:      
 
Domain Number 2 Region: 19-244
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.12e-34
Family ThuA-like 0.037
Further Details:      
 
Domain Number 3 Region: 253-400,446-560,593-674
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 9.81e-28
Family Soluble quinoprotein glucose dehydrogenase 0.00037
Further Details:      
 
Domain Number 4 Region: 891-1015
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-25
Family Family 6 carbohydrate binding module, CBM6 0.00052
Further Details:      
 
Domain Number 5 Region: 695-781
Classification Level Classification E-value
Superfamily PKD domain 1.57e-22
Family PKD domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290962250|ref|YP_003493432.1|
Sequence length 1173
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MSVLLSLVIAQPASAAPAFRALVFTKTAGYRHDSIPAGLAMFREQAAADNFELVHSEDSS
VFTAANLATFDVLIMFQTSGMVWTTASQRQAVEGYLASGKGIVSIHNATDMGIENEYPWW
DQTVNGGAHMPEHSPGVLAGTAVVADKKHPSTAGLPDRWNRSEEWYNFDRNPRGDVHVLV
TADERTYNPGPRAMGPDHPISWCRNTGGGRVWATAMGHASAAYSETPFRNHVLGGVEWAA
GKESGDCGGTVWSNFEKRTLDDNTADPMALAVAPDGRVLYVQRGGQLKIFKPSTNRTVTA
ATLSVYTGGEDGLTGLALDPDFADNGYVYLYHSPAGVPNDINRVSRFTLTGDTLNMSSQV
TVIDIPATRDRTFAEPGHTGGYIEFGPDKNLYIGTGDDVPPNLDPSWQGYAPLDWRQGKA
NLDAARTAGNTNDLRGKLLRIRPSADGGYSVPAGNLYPQGTAQTRPEIYAMGFRNPFRFS
IDPENGWVYLADYGPDRNPPTTNRGPEGLVELNVIKTPGNYGWPFCHGDNQAYAPYNPST
GVVGAKFNCNAPVNNSPNNTGLTSLKPIVAPNMWYGYGVSPNFPELGSGGSGPMGGPVYR
YDAANPSDTKFPPYYDGVHFFYEWSRHTVKEVHFDSATAVTRTNSFMPSAKFLKPMDMEF
GPDGSLYLLEWGNNFSGGNNDSGLYRIDYNHGGRSPVAKATATPTNGEAPLNVQFSSAGS
TDPDPGSTLSYHWTFGDGTTSTAAGPSHTYTANGNYTAQLKVTDNTGRTAFANVPITVGN
TAPTVTLTLPSNGGMLDFGDRVPYKVSVSDPGGGPVDCAKVFVNPALGHDDHQHETTDHP
GCSGTIDTSLLGGHPDGANLYYVLNARYTDDGGPGGANPLTGYAQAILQPKHKQAEFYSD
QSGVQIVEQAGAESGKRVGDISDGDWISFKPMSLSGVTNVRYRLSSPSGGGSIELRADSP
TGTLLATTPVPGTGGWNTYQSTAAVNTADLSGSHPLYLVFKGTSNNWFDLDALTFGGNGV
GEPGSGGGGGVAGRTWTVAAQHSGKFMDVNGASTADGAQVVQWPATGADNQKWQAVDAGG
GAVYLKAAHSDKCLAVTGGSTAQGAFLQQATCTNGNPQKFLVTPSTTAGVYTMKSAPSGL
CVDVNGGSTADGARLLQWSCHSGTNQQWRFTAV
Download sequence
Identical sequences C9ZEB1
gi|290962250|ref|YP_003493432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]