SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962264|ref|YP_003493446.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962264|ref|YP_003493446.1|
Domain Number 1 Region: 353-478
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.05e-33
Family Ricin B-like 0.00031
Further Details:      
 
Domain Number 2 Region: 40-329
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.23e-29
Family beta-glycanases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290962264|ref|YP_003493446.1|
Sequence length 485
Comment glycosyl hydrolase [Streptomyces scabiei 87.22]
Sequence
MPRTRRRRYLARALACILTVPSVPAAVAHESAAPTPADTSQFRGVNWARLGDNFHAGPLV
LHGLSASDSYRTVLAKADAVYTGFEKNLGANTVRLPINTYTVGTSWWNAYTGAIDAATAR
GFKVVLSYWDDGVAARGGRIVNPSAFDAMWNTVVARYGSDSLVHFEPMNEPAGHSAAEWA
NVASDWIAGRPSIPRNRIVVSGAGLNTDITSMCADRRLDGTLLSLHHYTFFSGAKTYDQW
MAHLRNALGSCADRTIVDEFGAPMDTGLNYRDAGSTDNFVRYFRATTTVLRELRIGSVYW
PGLGGKIRAGQGDDWYAMQKLHGTGTDLTLSTPSASGRERLRHGWGLDGDAPAPAGPVRN
VGTGRCLDIPGGTTANIQVQVTTCDDTVGQQWTVTADGQITALGGRRCMDAYNSGTTNGT
VVGTWACNGGDNQRWTVGGDGTVRSARSGLCLDVNTATFKAQLWACWGGDNQAWQIRKVS
DLPRS
Download sequence
Identical sequences C9ZEC5
WP_013005366.1.11737 WP_013005366.1.94791 gi|290962264|ref|YP_003493446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]