SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962511|ref|YP_003493693.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962511|ref|YP_003493693.1|
Domain Number 1 Region: 177-458
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.67e-29
Family Bacterial PLC 0.015
Further Details:      
 
Domain Number 2 Region: 43-166
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000476
Family Ricin B-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290962511|ref|YP_003493693.1|
Sequence length 465
Comment hypothetical protein SCAB_82131 [Streptomyces scabiei 87.22]
Sequence
MSLSRPHPRPRTRPRAHARALGAVAALTLGAPFAMPGTAAAAVPTHSVYLQNSVTGLNAA
AGGGTVAAHNPKGNEDHQQWTPVAVGGGHQLRNADQSGICLGRNGTSAVTAACGADGTTW
TVTEAAGSTYTIAVPGTAQYLTGVSSDSSLVQIGSNGDQARWYLTPVAPATTAIPSPGTR
TLDQVAFLTSHNAFANGADGNFASFPVSLFPNQSRGISRQLTDGVRGFMLDAYTVSGQAV
LCHNSCDGVGSPVPLATDLQRMVDFLKANPGQFATVFLEDYTSSDVLKASLASVRGLSDV
LYRPDQEGVATNGWPTMADLAARGKQLMVFSDRTRASDTSAGQATRNTFGVMYQREWTVE
NYWSMGGGLGGSDWSCYSRWGTSRPLTTDSAAFHPLFVMNHFRDYTISGTTETDNAKLGN
RAQNFCTPAARKKPNYLAVDRYELGSPSPLTTVADLNTYVLAAGQ
Download sequence
Identical sequences C9YU40
WP_013005609.1.11737 WP_013005609.1.94791 gi|290962511|ref|YP_003493693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]