SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962632|ref|YP_003493814.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962632|ref|YP_003493814.1|
Domain Number 1 Region: 20-344,371-478
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.44e-136
Family Amylase, catalytic domain 0.000000433
Further Details:      
 
Domain Number 2 Region: 486-561
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.12e-17
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290962632|ref|YP_003493814.1|
Sequence length 573
Comment alpha-amylase [Streptomyces scabiei 87.22]
Sequence
MTTNNPIPDTFEDTPQKDRDPDWFKRAVFYEVLVRSFQDSNGDGVGDLKGLTAKLDYLQW
LGIDCIWLPPFFKSPLRDGGYDVSDYTAVLPEFGDLADFVEFVDAAHQRGMRVIIDFVMN
HTSDQHPWFQESRNNPDGPYGDYYVWADDDKQFPDARIIFVDTEASNWTFDPVRKQYFWH
RFFSHQPDLNYENPAVQEEMISALRFWLDLGIDGFRLDAVPYLYQQEGTNCENLPATHDF
LKRVRKEIDAHYPDTVILAEANQWPEDVVDYFGDFASGGDECHMAFHFPVMPRIFMAVRR
ESRYPVSEILAKTPAIPSSCQWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMRANIG
IRRRLAPLLDNDRNQIELFTALLLSLPGSPILYYGDEIGMGDNIWLGDRDAVRTPMQWTP
DRNAGFSSCDPGRLSLPTIMDPVYGYQVTNVEASMSSPSSLLHWTRRMIEIRKQNPAFGL
GTYTELPSTNPSVLAYLREHGDDLVLCVNNFSRFAQPTELDLRAHEGRHPVELIGGVRFP
AIGELPYLLTLAGHGFYWFRLSRVLTRAAAPGR
Download sequence
Identical sequences C9YX35
WP_013005729.1.21818 WP_013005729.1.82449 WP_013005729.1.93747 WP_013005729.1.94791 gi|290962632|ref|YP_003493814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]