SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962633|ref|YP_003493815.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962633|ref|YP_003493815.1|
Domain Number 1 Region: 203-561
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.3e-84
Family Amylase, catalytic domain 0.0044
Further Details:      
 
Domain Number 2 Region: 566-642
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000864
Family alpha-Amylases, C-terminal beta-sheet domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290962633|ref|YP_003493815.1|
Sequence length 671
Comment alpha-amylase [Streptomyces scabiei 87.22]
Sequence
MSPIPAPAVGRVPVRDVRPLVECGRRPAKAVVGETFEVTATLFREGHGVVAANVVLKDPE
GRPAPWTTMRELAPGTDRWGACVTPTSVGRWTYRVEAWSDPIATWRHTARIKIPAGIDSG
LVLEEGAELYARAAAGVPEADLHAVLLTAVRRLRDDTVPVADRLAAALAPEVDEVLARHP
LRELVTSSEPLPLLVERERALFGSWYEFFPRSEGTPAQPHGTFRTAARRLPAIAAMGFDV
VYLPPIHPIGTTFRKGRNNTLSPTPDDVGVPWAIGSPEGGHDAVHPDLGTLDDFDHFISE
ARALGMEIALDFALQCSPDHPWVDKHPEWFHHRPDGTIAYAENPPKKYQDIYPIAFDADL
PGLVTETTRILRHWMDHGVRIFRVDNPHTKPVVFWEQVIADINATDPDVIFLAEAFTRPA
MMHTLAATGFQQSYTYFTWRTTKAELTEYATELAGEAAAYMRPNFFVNTPDILHAFLQEG
GRPAFELRAVLAATLSPTWGIYSGYELCENTPLKPGSEEYLDSEKYQLRPRDWDTAAHEG
RTIAPLITALNDIRRRHPALQGLRNLRFHHTDNDAVIAYSKRSGPDAVVVVVNLDPHRAQ
EATVTLDMPQLGLGAGDDVPVRDELTGESYRWGRTNYVRLEPGRAPAHVLHVHLPVDSTS
ASARTGGSATP
Download sequence
Identical sequences C9YX36
gi|290962633|ref|YP_003493815.1| WP_013005730.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]