SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962734|ref|YP_003493916.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962734|ref|YP_003493916.1|
Domain Number 1 Region: 407-694
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.14e-65
Family alpha-L-arabinanase-like 0.0035
Further Details:      
 
Domain Number 2 Region: 52-308
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.57e-29
Family alpha-L-arabinanase-like 0.018
Further Details:      
 
Domain Number 3 Region: 5-75
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.000044
Family Glycosyl hydrolases family 32 N-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290962734|ref|YP_003493916.1|
Sequence length 701
Comment beta-fructosidase [Streptomyces scabiei 87.22]
Sequence
MQEYAGYVFVYFTGEGRPDGERIRFALSRGNDPLRWRELNGGAPVLTSDLGTGGLRDPFL
VRAPEGDRFYLIATDLRMHGEPDGDWDRVQRTGSTSLMVWESTDLVHWTDRRRVRVAPDT
AGNVWAPEAVHDPERGEFVVFWASRLYAPDDPDHSADTHNRMLYATTRDFRVFSEPRLWN
DPGHSVIDSTVVRHDGTYYRFTKDERGNSPAAPGGKFITVEKSKELRATSYDFVADRIGH
GTVEQGEGPIVFRSNTDDRRWYLFVDEFSGRGYVPFETTDPGSGEWTPCTEFALPPGARH
GSVLPVTRAEYERLLAGYAPAASVVDADVPEGLKAYALVDHARSRVVLPLHPGAGLDALA
PEFSLSAGSRIDPPPGTPRDFRTPREYTVTAADGTARIWTVEAVPMRSPLLPGLYADPNI
QEFHGRYYVYPTTDGFEGWGGTRFEVFSSDDLVTWENHGVVLDLESDVSWADRHAWAPAA
GERDGSYYFYFCADQQIGVAVADSPTGPFRDALDRPLVGRDDYAGQMIDPAVFRDDDGTS
YLYWGNCEAYGVPLNEDMVSFDPARVRRFTPESFREGAFVVKRRGVYYFMWSEDDTRSED
YHVAYATGPTPLGPWTERGVILRKRPEYGILATGHHTVVNVPGTDDWFICYHRFAVPGPG
TPRGDGVRRESTLDRLVFAADGSIEEVVPTLESIVPVAGPR
Download sequence
Identical sequences C9Z007
gi|290962734|ref|YP_003493916.1| WP_013005831.1.11737 WP_013005831.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]