SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290962768|ref|YP_003493950.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290962768|ref|YP_003493950.1|
Domain Number 1 Region: 48-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.98e-57
Family alpha-L-arabinanase-like 0.00000587
Further Details:      
 
Domain Number 2 Region: 340-474
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.73e-37
Family Ricin B-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290962768|ref|YP_003493950.1|
Sequence length 476
Comment arabinase [Streptomyces scabiei 87.22]
Sequence
MTRHDTAPPRPGIRGRARRPALASILVALLTLLGLVTAGPAQALSGDLRMHDPSLIKVGS
CYYGFSTGFENDPLNPSGSITVRKTCAGTAASGWTKVGNVWSSTPSWITAKLGSTPPNIW
APDVKYFNGKYHLYYAGSLWGSAYAVMGLATATDIEGPWTDQGMVTDVNYPIDPNVDWGP
DGRLYITWGSFTGPGTYMHVLDEATGKLSTTDNNLWHLAVGIENPTIILNGGYYYLFGSK
GLCCSGTNSNYYTVVGRSTSITGPYLDQSGVNMLSNGGTTVLTGARPRVAAGGADAYDDG
VSKFLAYHYYDADNAGRETLDIRQVTFANGWPVLAGPLGAANNHLLNRNADKCADVWFAS
TADEASVNSGNCNSGTNQQWVSTAVGSDYRLVNVNSGKCLQIAGAATANGAAAVQSTCTG
ASHQLWRKTAVIGGYVTYTNVNSGKCLQVAGASTANGAALEQSTCNAGANQQWMVV
Download sequence
Identical sequences C9Z041
WP_013005865.1.11737 WP_013005865.1.94791 gi|290962768|ref|YP_003493950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]