SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290963185|ref|YP_003494367.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290963185|ref|YP_003494367.1|
Domain Number 1 Region: 907-1042
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.69e-37
Family Ricin B-like 0.0031
Further Details:      
 
Domain Number 2 Region: 43-143,328-351,392-654
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.06e-33
Family Pectate transeliminase 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290963185|ref|YP_003494367.1|
Sequence length 1045
Comment hypothetical protein SCAB_89091 [Streptomyces scabiei 87.22]
Sequence
MLDRPNQQEGKTMNHVTSPVRSLSAVLAISLSAALLTSLATPTPAAAATQATYYVSPDGN
DSDSGTISAPFKTLQHARDVVRTVNDDMTGDINVYLRGGTYPVTSTINFTSADSGTNGNR
VVYAAYPGEKPVLEGGVPVTGWTQHSGNIWKATLDRDNKLRALYVDGKRARMASKTISSA
GCYGANYKVEAPLPSWAWETGQTCDASKYGLSDLPAIASNQDDVEIRSATTWTSAIVGVR
EVTTSSDGAQRVAKFQEPGAAIAQGAYNGNFQAGGTQTFMNAYEFLDQAGEFYFNKTSHT
LYYYKSGSEDMTTAKVFAPNNVSTILKIAGTSRTDHARDITFSGLTVEHSDWNLVKVGDS
VFRQGQQGNVTATVYARKNFHAYTYRNVDLQPAMIQVESADGINLQRNTVQHTGADAITL
ANDVTDSQVTGNYVNDTAGSAITVGHPQHVYIGDYAQDPREKYPVNVEGVCKDITVRNNY
LYDSAVLFEGSNPVSAYFVDTLAVEHNRIEKSPWAGISLGWGWWNFNGDSDAVVPGTPTT
TAKNNSVRYNEIIDTMQTLADAGPVYTLGRQPGTEVSGNYMQGVPAGHKYGIHPDEGSAG
ISFHDNVLDVDPGVTSTIHSGEWGRQKDLSITNTYGTVNKIFDQTVTSSTIQDVRAYADN
VWPSEAYDIALDAGLEDAYKDLVPRSRVALQDYVLPAATFAGKGVSSVPVRGTGDAAKTL
WLAPSGTTTFAVGPTMTKASGTATAIAVPPSAGDYRLYVVDAQGDASAASKALVRQRWAY
ADDKAASVTYSSGWSNWNDTKDVNGSEKFTSASGNYAEYSFTGTGIRYLGMKQPNMGKVD
VYLDGTLAQSGIDAYASTVTKQVPLFEKTDLAAGPHTIKIVCTGTKNASSSNTVCALDAF
AHIAFPAKNGFYKMLNKGSGKAVDISGGSDADGASIIHWTDGGAQNQRWRYVPVGDGSYE
IVSQDTGKLVDVKDGLTTDGAGIVQWSDNNGANQHWTLVATGNGYYKIKNVKSDKLLALA
PSGSQLVQTTDTNADGQLWKIVNVD
Download sequence
Identical sequences C9Z7U1
gi|290963185|ref|YP_003494367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]