SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|290955042|ref|YP_003486224.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955042|ref|YP_003486224.1|
Domain Number 1 Region: 920-1062
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-34
Family Ricin B-like 0.0011
Further Details:      
 
Domain Number 2 Region: 130-333
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.77e-18
Family beta-glycanases 0.026
Further Details:      
 
Domain Number 3 Region: 742-864
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000034
Family delta-Endotoxin, C-terminal domain 0.056
Further Details:      
 
Domain Number 4 Region: 460-590
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000948
Family Family 6 carbohydrate binding module, CBM6 0.015
Further Details:      
 
Domain Number 5 Region: 613-730
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000374
Family Family 6 carbohydrate binding module, CBM6 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290955042|ref|YP_003486224.1|
Sequence length 1065
Comment hypothetical protein SCAB_4501 [Streptomyces scabiei 87.22]
Sequence
MRRLGQRRSASRRLLHGITRTLLPLTVMAGLTTAIAAPASAATPTLTVDLGTSTGAFHGG
ASGVLYGLYGPDVPTGNLIEGMGVRTTNTKYQDGQQHPGSDALEIAEPFVDSGGKDIYIY
MTDVYRTFSYERTSYAAYRTAMKKQIDQVLATPYKDRVVLVPYNEPDGMWYPGMRTQATA
LADFNAEWRQTYTFIKGLWPEARIAGPNTSSYTESSLKGFLTYCKANNCLPDIATWHTLG
SPAEVSSTVDNYRAAETAVGLPSHLPINLNEYAFRYHLTDPGQMVQWIAALEDKKIDGNL
PYWNINGNLGDSAAGQNIPNAQWWLYHWYSSMKGGNTVKVTSSGADAAYTLQGLASLDTA
KKQARVILAGGGTSGASDTVIKNIDPAVFGSTVHVSVFQDRYSGYIGAAATPTRLSDADV
AVGSDGSITVPLDLDAMSAYQVIVSPGGNGSATASDSTWTRSYEAENATLSGSGYNINTE
GTPSRLDKFATSGTKDVGGLRTGSTTVISFPVTVPTTGDYDLSVFGNSYAKDADVKGPTN
VYLRVDGGASKRIDIPVGFQWVVWGHSDTTVNLTAGTHTLTLATTGDNGAATVGDAIIDK
IDLRYRDTGVQATTLYEAEQAALSDSGSTTYTSQGQSGAGAVNLTSGRSATFWVYAARDG
YADLTARFRNTGQADLTVNGRAADDQVLSGATTAAWSTSTNRFFLKAGINKIKVTGTGGT
LALDDLAVTPFSTTSAVTTGNVVTYQAEAGTLTGTAEVSNSYDQATGGVVTGIGNGTANS
LTLDVDAPSAGTYAMTMRYANAEELPSNHYNPDLYAEHADVGVNGGDATRVDFAGTLHWN
QFADYTAHVTLKKGANKVKFTSSQLYDWDGTTVGKVYSGGGSDIGQPLRSSSAPHLDQVS
FAPASLHIGAPAAFSSTAVAQHSGLCLEDPARSSANGTQYRQNTCGSGQEQLFDFRRVSG
TTDTYTVVNHSSGKCLDVSAYSTADGAAVQQWTCHGDTNQRFRLAPVTALGNSHDYQLVA
VHSGKCVDVSTISTAPGALVHQWPCDGAGALTTKKNQIWRLTGKD
Download sequence
Identical sequences C9YSX8
WP_012998389.1.11737 WP_012998389.1.94791 gi|290955042|ref|YP_003486224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]